SecReT4
Protein ID: 68248659
T4SS name [ID]Tfc [47]
Gene symbol-
Locus tagNTHI0125
StrainHaemophilus influenzae 86-028NP
Repliconchromosome [GenBank: NC_007146] [Browse all T4SS(s) in this replicon]
Location [Strand]111127..113376 [+]
Producthypothetical protein
Component typeTfc6
UniProt IDQ4QPD6
KEGG IDhit:NTHI0125
PDB IDNA
Domain hit(s) vs Pfam TraG-D_C [PF12696], Evalue: 5.2e-18, Aligned region: 503..632
TrwB_AAD_bind [PF10412], Evalue: 2.9e-14, Aligned region: 498..643
AAA_10 [PF12846], Evalue: 1.1e-11, Aligned region: 184..580
DUF87 [PF01935], Evalue: 9.3e-05, Aligned region: 185..228
Protein Sequence: 749 a.a.     [Download]
>gi|68248659|ref|YP_247771.1| hypothetical protein NTHI0125 [Haemophilus influenzae 86-028NP]
MSQKHVLEGLLRPPVEFFPAAVHGTCALVCCGAPWSLALNPLIGYGLGAAFAGMGVMRFRQGMEIVRYHR
NLRRLPHYALTSRQIPVSKKALFLGRGFEWEPKHTQRLYDCFSANGQIYWKNGKWFKAARDYEKVHDNWL
SRLTSMDSPLNPVRPLPPVGGIPVMHGVEPNERDIMLPLGDRGGHTLVFGTTGVGKTRFAEVLVTQDIHR
GKTPEEREVVVFFDPKGDPDMLKRMYAEAKRAGRENEFYVFHLGHPEISARYNPVGRFGRISEVAGRISG
QLSGAGNSAAFKEFAWRFVNIVSRALVEMGKRPDYVQISRFVQNIDALFLDYAKLHFDAVDKKIWPTLAS
VAANLDVKNLPFSMKDRPLIAVINQYILENKIFDPVLEGLSSAVRYDKTYFDKIVASLLPLLEKLTTGKT
AELLSPDYTDIHDERPIFDWESIIRKRGIVYVGLDALSDATVAAAVGNSMFADLVSMAGHIYKFGVDEGL
PDAFKTKSKPPKINLHCDEFNELMGDEFIPLINKGRGAGMQVTAYTQTLSDIEARIGSKAKTGQTTGNFN
TLLMFRVKEPATAEFLTRQLNDVTIYQSMVTSSTTDNSNPDDGKAFTSNTGERISEKMVPMLSPAHITNL
PKGQAFALLEGSTLYKLRMPLPAVDKDDVMPESLQELTAYMRKNYHISPNWWQSAFSDYAPSQDIATAFQ
SMSLNRAPSHAGEEMLFGDVEAPVAEDMEDEDIDQNDDTDEDDFDDTDN
 
Nucleotide Sequence: 2250 bp     [Download]
>gi|162960935|ref|NC_007146.2|:111127-113376 Haemophilus influenzae 86-028NP chromosome, complete genome
ATGAGTCAAAAACATGTATTAGAAGGTTTACTTAGACCGCCTGTTGAATTTTTTCCAGCTGCCGTCCATG
GTACTTGTGCTTTGGTTTGTTGCGGTGCGCCTTGGTCGCTCGCATTAAATCCTCTTATTGGATATGGATT
AGGGGCCGCTTTCGCAGGTATGGGGGTTATGCGTTTTCGTCAAGGCATGGAAATTGTACGCTATCACCGA
AATTTACGCAGACTCCCTCACTATGCTTTGACCAGTCGTCAAATTCCAGTAAGTAAAAAAGCCTTGTTCT
TAGGACGAGGCTTTGAATGGGAACCAAAGCATACGCAACGTCTTTATGACTGTTTCTCTGCAAATGGGCA
AATTTATTGGAAAAATGGGAAGTGGTTTAAAGCCGCTCGTGATTATGAAAAAGTGCATGATAATTGGTTA
TCTAGACTCACTTCAATGGACTCTCCATTAAATCCAGTCAGACCGCTACCGCCAGTTGGCGGCATTCCAG
TGATGCATGGTGTGGAGCCGAATGAACGCGATATTATGCTTCCGTTAGGCGACCGTGGCGGTCATACCTT
AGTATTTGGTACAACTGGCGTAGGGAAAACGCGTTTTGCTGAAGTGCTTGTTACACAAGATATACATCGA
GGTAAAACACCTGAAGAGCGTGAAGTGGTTGTCTTTTTTGATCCGAAAGGCGACCCGGATATGTTAAAAC
GAATGTATGCAGAAGCAAAACGTGCGGGGCGTGAAAATGAATTTTATGTATTCCATTTAGGGCATCCGGA
AATTTCTGCTCGATATAACCCAGTTGGTCGCTTCGGTCGAATTTCTGAAGTGGCAGGACGTATTTCTGGG
CAATTAAGTGGTGCGGGAAATAGTGCAGCATTTAAAGAGTTTGCGTGGCGTTTTGTGAATATTGTCTCCC
GTGCATTGGTTGAAATGGGAAAACGCCCGGACTATGTGCAAATCTCGCGTTTTGTGCAAAATATTGATGC
ACTTTTCTTAGATTACGCCAAACTTCATTTTGATGCCGTAGATAAGAAAATATGGCCAACGTTGGCTTCG
GTTGCGGCTAACTTAGATGTAAAAAATTTACCGTTCTCGATGAAAGATAGACCGCTGATTGCTGTTATTA
ACCAATATATTTTAGAGAATAAGATTTTTGACCCGGTACTTGAAGGGTTATCAAGTGCGGTACGTTACGA
TAAAACCTATTTTGATAAAATTGTGGCATCGCTTTTACCGTTACTTGAAAAACTCACTACAGGTAAAACT
GCAGAGCTTCTCTCGCCTGATTACACTGATATTCATGATGAGCGCCCTATCTTTGATTGGGAATCTATTA
TTCGTAAAAGAGGGATTGTTTACGTTGGATTAGATGCATTATCCGATGCGACCGTAGCTGCAGCTGTGGG
TAATAGTATGTTTGCTGATTTGGTATCAATGGCTGGTCATATTTATAAATTTGGCGTAGATGAGGGGTTG
CCAGATGCATTTAAAACTAAAAGCAAACCGCCTAAAATCAACCTTCATTGCGATGAGTTCAATGAATTGA
TGGGGGATGAATTTATCCCGCTGATCAATAAAGGTCGTGGTGCGGGAATGCAGGTAACAGCCTATACTCA
AACACTTTCAGATATTGAAGCTCGTATTGGAAGTAAGGCAAAAACGGGACAAACAACAGGTAACTTCAAT
ACACTTTTAATGTTCCGGGTAAAAGAGCCGGCCACTGCAGAGTTTTTAACGCGTCAGCTCAACGATGTCA
CAATTTATCAAAGCATGGTGACATCAAGTACGACAGATAACAGCAATCCGGATGATGGCAAGGCGTTTAC
TTCTAATACTGGTGAACGTATTTCTGAAAAAATGGTGCCAATGCTATCGCCAGCACATATTACAAATTTA
CCAAAAGGACAGGCATTTGCTCTTCTTGAAGGGAGTACGCTTTATAAATTAAGAATGCCTTTACCTGCGG
TTGATAAAGATGATGTGATGCCGGAATCACTTCAAGAATTGACGGCTTATATGCGCAAAAACTACCATAT
TTCTCCAAATTGGTGGCAATCTGCATTTTCTGATTATGCGCCAAGTCAAGATATAGCAACCGCTTTTCAG
TCAATGTCATTAAATCGAGCGCCTTCACACGCAGGAGAAGAAATGCTTTTCGGGGATGTTGAAGCTCCAG
TTGCTGAAGATATGGAAGATGAAGATATTGATCAGAATGATGATACAGATGAGGATGATTTTGATGACAC
AGATAATTAA
 Primer design