SecReT4
Protein ID: 68248660
T4SS name [ID]Tfc [47]
Gene symbol-
Locus tagNTHI0126
StrainHaemophilus influenzae 86-028NP
Repliconchromosome [GenBank: NC_007146] [Browse all T4SS(s) in this replicon]
Location [Strand]113695..114381 [+]
Producthypothetical protein
Component typeTfc8
UniProt IDQ4QPD5
KEGG IDhit:NTHI0126
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 6.5e-66, Aligned region: 38..225
Protein Sequence: 228 a.a.     [Download]
>gi|68248660|ref|YP_247772.1| hypothetical protein NTHI0126 [Haemophilus influenzae 86-028NP]
MAEQQVKKKKKGLFYYINAVLAALLGSLILSIILEWLGIAFLWPEEGHLHSQKMMLTELGWLSDSLTRGL
FYHSPKELAEGLILSLHEWLFVKTGVKDWLANPREHSGVGLWVYHYGRAYIESVIYVFITFVIRLVVIVF
TSPLFLLAAFAGFTEGLMMRDRRKFGAGRESSFLYHHARRLIGPIMLSAWVLYLSIPISIYPNIILVPAA
FLFGLSICVTAASFKKYL
 
Nucleotide Sequence: 687 bp     [Download]
>gi|162960935|ref|NC_007146.2|:113695-114381 Haemophilus influenzae 86-028NP chromosome, complete genome
ATGGCAGAACAACAAGTCAAAAAAAAGAAAAAGGGTCTTTTTTACTACATTAATGCGGTATTAGCCGCCT
TATTGGGTTCCCTGATTTTGAGCATTATTCTTGAATGGTTAGGTATTGCATTTTTATGGCCTGAAGAAGG
TCATTTACACAGTCAAAAAATGATGCTAACTGAGCTTGGATGGCTTTCTGATAGTCTAACGAGAGGTCTT
TTCTATCATTCTCCAAAAGAGCTGGCTGAAGGTCTTATTTTGTCATTACATGAATGGCTTTTTGTGAAAA
CAGGTGTAAAAGATTGGTTAGCCAACCCTCGTGAGCATAGTGGCGTAGGTTTGTGGGTGTATCATTATGG
GCGAGCGTATATTGAGTCAGTGATTTATGTTTTTATCACCTTTGTTATTCGACTTGTAGTGATTGTTTTT
ACTTCCCCACTCTTTTTGTTAGCCGCATTTGCGGGCTTTACTGAAGGGTTAATGATGCGTGACCGTCGTA
AATTTGGTGCGGGCAGAGAGTCTAGTTTTCTTTATCATCATGCACGTCGATTAATTGGCCCGATTATGTT
GTCGGCATGGGTATTGTATCTTTCTATCCCAATTTCTATTTACCCGAATATAATTTTGGTGCCAGCTGCA
TTTCTATTTGGACTATCCATCTGTGTAACGGCAGCGAGCTTTAAAAAATACCTTTAA
 Primer design