SecReT4
Protein ID: 68248661
T4SS name [ID]Tfc [47]
Gene symbol-
Locus tagNTHI0127
StrainHaemophilus influenzae 86-028NP
Repliconchromosome [GenBank: NC_007146] [Browse all T4SS(s) in this replicon]
Location [Strand]114512..114862 [+]
Producthypothetical protein
Component typeTfc9
UniProt IDQ4QPD4
KEGG IDhit:NTHI0127
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 4.4e-29, Aligned region: 28..110
Protein Sequence: 116 a.a.     [Download]
>gi|68248661|ref|YP_247773.1| hypothetical protein NTHI0127 [Haemophilus influenzae 86-028NP]
MESVSSKEFSVTKNIFSLSLAIGLLFGAISAQATEQEHLAQAIKQLDAAKLSLQRAAASAKVSAKSREYF
DYASAHQDIATVQAGIKQYINPSRAIPRNPKAIRNLKEDYLNLRSQ
 
Nucleotide Sequence: 351 bp     [Download]
>gi|162960935|ref|NC_007146.2|:114512-114862 Haemophilus influenzae 86-028NP chromosome, complete genome
TTGGAATCTGTTTCAAGTAAGGAGTTCTCCGTGACTAAAAATATTTTCAGTTTATCTCTAGCAATAGGGT
TATTGTTTGGCGCTATAAGTGCTCAAGCAACAGAGCAAGAGCATTTAGCGCAAGCAATTAAACAGTTGGA
TGCAGCAAAACTCTCATTACAGCGAGCAGCTGCAAGTGCAAAGGTTTCTGCGAAAAGTCGTGAATATTTT
GATTACGCTTCAGCACATCAAGATATTGCTACGGTACAGGCAGGGATTAAGCAATATATTAACCCTTCCC
GGGCAATCCCTAGAAATCCTAAAGCTATTCGTAACTTAAAAGAAGATTATCTCAATCTTCGGAGTCAATA
G
 Primer design