SecReT4
Protein ID: 68248663
T4SS name [ID]Tfc [47]
Gene symbol-
Locus tagNTHI0129
StrainHaemophilus influenzae 86-028NP
Repliconchromosome [GenBank: NC_007146] [Browse all T4SS(s) in this replicon]
Location [Strand]115552..115923 [+]
Producthypothetical protein
Component typeTfc11
UniProt IDQ4QPD2
KEGG IDhit:NTHI0129
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 3.2e-40, Aligned region: 6..121
Protein Sequence: 123 a.a.     [Download]
>gi|68248663|ref|YP_247775.1| hypothetical protein NTHI0129 [Haemophilus influenzae 86-028NP]
MSSDKEQTIPFLPTRLNRESSVYGGLSVSEFMLAAAMGFILGAVLGLLCCFALGFDFWLLIPSLAMLFCI
LSVVIGKVIIARLKRGKPEAYLNRMIEVKLDGILGGNRFISRQGTWSIRRVKK
 
Nucleotide Sequence: 372 bp     [Download]
>gi|162960935|ref|NC_007146.2|:115552-115923 Haemophilus influenzae 86-028NP chromosome, complete genome
ATGTCAAGCGATAAAGAACAAACAATCCCCTTTCTTCCTACTCGATTAAATCGTGAATCGAGTGTGTATG
GCGGGTTATCTGTAAGTGAATTTATGTTGGCTGCAGCAATGGGATTTATCTTGGGTGCAGTGCTTGGCCT
CCTTTGTTGTTTTGCCTTAGGCTTTGATTTTTGGTTGTTAATTCCGTCTCTCGCCATGTTGTTTTGCATT
CTTTCTGTGGTGATTGGCAAAGTGATTATTGCGCGCCTTAAACGAGGTAAGCCGGAAGCCTACTTGAATC
GAATGATTGAGGTTAAATTAGATGGAATATTAGGGGGGAATCGCTTTATCTCCCGTCAAGGCACTTGGTC
TATTCGCCGAGTTAAAAAATAA
 Primer design