SecReT4
Protein ID: 68248664
T4SS name [ID]Tfc [47]
Gene symbol-
Locus tagNTHI0130
StrainHaemophilus influenzae 86-028NP
Repliconchromosome [GenBank: NC_007146] [Browse all T4SS(s) in this replicon]
Location [Strand]115935..116579 [+]
Producthypothetical protein
Component typeTfc12
UniProt IDQ4QPD1
KEGG IDhit:NTHI0130
PDB IDNA
Domain hit(s) vs Pfam DUF2895 [PF11444], Evalue: 1.8e-85, Aligned region: 8..203
Protein Sequence: 214 a.a.     [Download]
>gi|68248664|ref|YP_247776.1| hypothetical protein NTHI0130 [Haemophilus influenzae 86-028NP]
MSNLKGIVHQKNREIMTGRIAIGALLVICLVLCAIIFTAPSRLMIYNPPDLRAGSQRPWWEVPKSTVYAF
AYQTFQQLNRWMENGEEEYKLNIERNKAFITPSCQEFLKKDYYDRLSNGELRERARGVYEIVGRGFKDSS
VIVHSPDSWTVNLDLSVDEYFKDEPVKRVLTRFPVNIVRMETDLQNNPWGLGFNCYSSIPLRLEAKEFRE
GDNQ
 
Nucleotide Sequence: 645 bp     [Download]
>gi|162960935|ref|NC_007146.2|:115935-116579 Haemophilus influenzae 86-028NP chromosome, complete genome
ATGAGTAACTTAAAAGGGATTGTTCATCAAAAAAATCGCGAAATCATGACCGGGCGAATTGCTATCGGTG
CATTGCTTGTGATTTGTTTGGTGCTATGTGCCATTATTTTTACCGCACCAAGTCGATTAATGATTTATAA
CCCACCGGATTTACGTGCGGGAAGTCAACGCCCTTGGTGGGAAGTGCCAAAATCAACCGTTTATGCCTTT
GCTTATCAAACCTTCCAGCAGTTAAACCGCTGGATGGAGAATGGCGAGGAAGAATACAAATTAAATATTG
AAAGAAATAAAGCCTTTATTACGCCAAGTTGCCAAGAATTTTTGAAGAAAGACTACTATGACCGTTTATC
TAACGGTGAATTACGTGAACGTGCACGTGGTGTTTATGAAATTGTGGGACGTGGATTTAAAGACAGTAGC
GTTATTGTGCATAGTCCAGATAGCTGGACGGTTAATCTTGATTTAAGTGTAGATGAGTATTTCAAAGATG
AACCAGTAAAACGTGTTTTAACCCGCTTCCCGGTCAATATCGTGCGCATGGAAACAGATTTACAGAACAA
TCCTTGGGGATTGGGATTTAACTGCTACAGCTCAATTCCATTACGTTTAGAAGCAAAAGAATTTAGAGAA
GGGGATAACCAATAA
 Primer design