SecReT4
Protein ID: 68248665
T4SS name [ID]Tfc [47]
Gene symbol-
Locus tagNTHI0131
StrainHaemophilus influenzae 86-028NP
Repliconchromosome [GenBank: NC_007146] [Browse all T4SS(s) in this replicon]
Location [Strand]116579..117448 [+]
Producthypothetical protein
Component typeTfc13
UniProt IDQ4QPD0
KEGG IDhit:NTHI0131
PDB IDNA
Domain hit(s) vs Pfam DUF3438 [PF11920], Evalue: 4.6e-115, Aligned region: 3..278
Protein Sequence: 289 a.a.     [Download]
>gi|68248665|ref|YP_247777.1| hypothetical protein NTHI0131 [Haemophilus influenzae 86-028NP]
MKKLTLLLSAAFIFSPMTASADVLMKWARKPLPIDLQIEKERILFVDKNVKVGYPPELDSKLRIQSTGGA
VYLKATADFPKTRLQLMDVATGEIILLDVQAKHSVANASEPIRFVYENKVEKQTTAYGQDANAYNEPMPN
ARPALPAPAALTRYAAQMFYAPLRSVEPLEGVRQVSHRLPTPLKTLLPALPVRATPLLSWQLDEYVVTAV
RLQNQGQSRIDLDPRELQGRFYAATFQHNWLGGHDTPEDTTTLYLVTEGSPNHSVIPQSNSYKPKKLKKV
TTTVTTQTK
 
Nucleotide Sequence: 870 bp     [Download]
>gi|162960935|ref|NC_007146.2|:116579-117448 Haemophilus influenzae 86-028NP chromosome, complete genome
ATGAAAAAACTCACTTTGTTACTAAGCGCGGCTTTTATCTTTTCACCAATGACGGCATCTGCCGATGTGT
TAATGAAATGGGCGCGCAAACCGTTACCTATTGACTTACAAATCGAAAAAGAACGTATTCTATTCGTAGA
TAAAAATGTAAAAGTAGGTTATCCACCTGAATTAGATAGCAAGCTTCGCATTCAATCAACTGGCGGTGCG
GTTTATTTAAAAGCAACTGCAGATTTCCCAAAAACACGCTTGCAGCTTATGGATGTTGCAACTGGAGAAA
TAATCTTACTTGATGTGCAAGCGAAGCATTCTGTTGCCAATGCAAGTGAGCCAATTCGCTTTGTTTATGA
AAATAAAGTTGAAAAACAAACAACTGCTTATGGCCAAGATGCAAATGCATATAACGAACCAATGCCAAAT
GCGCGTCCGGCACTCCCCGCTCCAGCTGCATTAACACGTTATGCCGCACAAATGTTTTATGCGCCTTTAC
GTTCAGTTGAGCCTTTGGAAGGTGTGCGCCAAGTTTCACATCGCCTTCCTACACCGCTTAAAACGCTCTT
ACCTGCATTGCCTGTGCGAGCTACTCCATTACTCAGCTGGCAACTTGATGAGTATGTTGTCACTGCGGTT
CGCTTGCAAAACCAGGGGCAATCTCGCATTGATTTAGATCCTCGAGAGCTTCAAGGTCGATTCTATGCAG
CAACATTTCAGCATAATTGGCTTGGGGGGCATGATACACCTGAAGATACCACAACGTTATATCTTGTGAC
AGAAGGTTCACCTAATCATTCTGTTATCCCTCAGTCAAATTCATATAAACCGAAAAAATTGAAAAAAGTC
ACCACAACAGTGACAACTCAAACAAAATAA
 Primer design