SecReT4
Protein ID: 68248666
T4SS name [ID]Tfc [47]
Gene symbol-
Locus tagNTHI0132
StrainHaemophilus influenzae 86-028NP
Repliconchromosome [GenBank: NC_007146] [Browse all T4SS(s) in this replicon]
Location [Strand]117459..118859 [+]
Producthypothetical protein
Component typeTfc14
UniProt IDQ4QPC9
KEGG IDhit:NTHI0132
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 4.4e-06, Aligned region: 263..445
Protein Sequence: 466 a.a.     [Download]
>gi|68248666|ref|YP_247778.1| hypothetical protein NTHI0132 [Haemophilus influenzae 86-028NP]
MQMKANKAFYVIGGITALVVTLMAGFLFSGSSSTNTAETKKEDTLDISFKDLSPEELRAMGIEGDTSKDT
VRTLIGKVKEHNKRFDEVILQNERLVKENEQLKNQANNTDYQIQQAVQAETGALINEINALKDQVVQAGN
QVVGNGNAQANPNAPLPINGATTGPQVETRGGINWVNPSDMPTTDRQGNALQGIGVNGAGIGFPKTFDNN
VNDIRKSNDGLQSSTGNNAIFNTATPFFTIAANSTLTNSVAMTALVGRVPIDNKVTEPYPFKLLIGRDNL
IANGIELPDIEGAIVSGTASGDWTLSCVRGDVKSLTFVFSDGRIVSTDNSDDKIGWLSDPHGVPCIPGER
RTNAPEYLTTNFFLTGASAAAQGLSSSQSTTVVDGGAVIGAVTGNNGKYILGQALGGGLRETADWFRQRY
GQMFDAVYVPPGKEVAVHIEKQIDIDYDRMSRKVKYGQASRQSNLD
 
Nucleotide Sequence: 1401 bp     [Download]
>gi|162960935|ref|NC_007146.2|:117459-118859 Haemophilus influenzae 86-028NP chromosome, complete genome
ATGCAAATGAAAGCAAATAAAGCGTTCTATGTTATTGGTGGGATTACCGCTCTTGTCGTGACGCTGATGG
CTGGATTTCTTTTCTCCGGTAGTAGTTCAACAAATACAGCAGAAACCAAGAAAGAAGATACTTTAGATAT
CTCTTTTAAAGATTTATCACCGGAAGAATTACGAGCAATGGGGATTGAGGGTGACACATCTAAAGATACG
GTAAGAACACTTATAGGTAAAGTGAAAGAGCATAATAAGCGATTTGATGAAGTGATTTTACAAAATGAAC
GCTTGGTAAAAGAGAATGAGCAGTTAAAAAATCAAGCAAACAATACGGATTATCAAATTCAACAGGCGGT
ACAAGCAGAAACAGGGGCGTTAATTAATGAGATTAATGCGTTAAAAGATCAGGTTGTACAAGCTGGTAAT
CAAGTTGTAGGGAATGGAAATGCCCAGGCAAATCCCAATGCTCCTCTACCAATAAACGGAGCAACAACTG
GCCCTCAGGTTGAAACTCGAGGGGGAATTAATTGGGTGAACCCTAGTGATATGCCAACTACAGACAGACA
AGGGAATGCTCTACAAGGTATTGGTGTAAATGGTGCAGGAATCGGTTTTCCCAAAACCTTCGATAACAAT
GTGAATGACATCCGAAAATCTAATGATGGGTTGCAATCTAGTACAGGTAATAATGCAATATTTAATACCG
CTACACCATTTTTCACAATTGCAGCTAACTCTACTTTAACTAATTCTGTTGCTATGACTGCGCTTGTTGG
GCGTGTGCCGATTGACAATAAGGTAACCGAGCCTTATCCGTTTAAATTGCTTATTGGTCGAGATAACTTA
ATTGCAAATGGCATTGAACTGCCGGATATTGAAGGCGCAATTGTCTCTGGAACAGCAAGCGGTGACTGGA
CGCTATCTTGTGTTCGTGGTGATGTGAAAAGCTTAACTTTTGTGTTTAGCGATGGCCGCATTGTTTCAAC
AGACAATTCTGACGATAAAATTGGCTGGTTATCTGATCCACATGGTGTGCCTTGCATTCCTGGAGAACGC
AGAACAAATGCTCCGGAATATCTAACGACCAACTTCTTCTTAACGGGGGCTTCAGCAGCTGCACAAGGCT
TATCATCTTCTCAATCAACAACAGTGGTTGATGGCGGTGCAGTAATTGGTGCGGTAACGGGTAATAACGG
TAAGTATATTCTTGGTCAAGCGTTAGGTGGCGGTTTGAGAGAAACAGCAGACTGGTTCCGTCAGCGTTAT
GGCCAAATGTTTGATGCGGTATATGTTCCACCGGGTAAAGAAGTGGCTGTACACATCGAAAAACAAATTG
ATATTGATTATGACCGCATGTCTCGAAAAGTGAAATACGGACAAGCCTCAAGACAATCTAACTTGGATTA
A
 Primer design