SecReT4
Protein ID: 68248668
T4SS name [ID]Tfc [47]
Gene symbol-
Locus tagNTHI0134
StrainHaemophilus influenzae 86-028NP
Repliconchromosome [GenBank: NC_007146] [Browse all T4SS(s) in this replicon]
Location [Strand]119292..122162 [+]
Producthypothetical protein
Component typeTfc16
UniProt IDQ4QPC7
KEGG IDhit:NTHI0134
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 7.6e-64, Aligned region: 72..340
AAA_10 [PF12846], Evalue: 6.2e-34, Aligned region: 534..866
Protein Sequence: 956 a.a.     [Download]
>gi|68248668|ref|YP_247780.1| hypothetical protein NTHI0134 [Haemophilus influenzae 86-028NP]
MALFQDVLEAFFPAKKGDKPQPKKEPILTSIAPEEAQQDDTNNVEETIEITPVMRNRKMTREQHVKMLYG
RDPSFISNLPYAEYLEEEGVMLFDDAKSAGAVFDIKPIGTEGRSSDYLNRVRTLVKDALQDSFDELDTNP
YVVQFYCQDDKDLSGYVENLRQYIKTTSPEASGSEFTEQWLGEMERHLKAVGKPGGLFVDDRVTNTAWAG
KVRKTRMVIYRYAGNNETDTIEKLNTACDRVQSAFITAGLTMERQNETQIHRWLLEWFNPNPSRYFNGLD
DKACYDLLSLSKDESALPLQDQDFSENLFFTPPESKNGYWYFNEQPHEVIVVDNIRKQPDVGHMTGEVTR
GRNINALFDLLPESTIMAITVVIHPQDKLQAHLDKLSSRAVGNNYESIYLKQDALTVTEYLKDGHKLYQA
GMVFYVRGKDDQELRIRSRELRTVLLSNNLVPVKEGNEVAPLNSYLRWLPMNFNPQLDAKSRFYTKYYWV
QHIANMLPVFGRETGTGHPGITYFNRGGSPLDFDPLNPKDRTKNAHKLILGPTGSGKSATLTAQMAQLMA
VHRPRLFIVEAGNSFGLFSDYAERYGLTVNRVSLEPSSNIALPLFSEAHRLLEMDIDLEVQDDDDNEDEG
EEQRDLLAEMELTARLMITGGEAKEDEKMSRADRSAIRQAILLAAEKTSQETPPRQVLTGDVKAALEELS
RRQDIRPERASRLADMAEAMDIFCTGVNGRFFNREGEIWPEADITLVDLAMFARDGYEAELAISYISLIN
HINSLGEKYQHSFRPIVNITDESHIITVNPLLAKFLVKGSKMWRKLGIWLWLATQNMADFPDESDKLLSM
VEWWELLNLSNDEVEQVNRFRRLSEAQKMMLLSAKKADKKYTEGVVLATNMEALFRVVPPSLYLALGMTE
KHEKAQRKQLMMEHNCTELDAALMVAKDLDKKRGIAVNDELNSIAA
 
Nucleotide Sequence: 2871 bp     [Download]
>gi|162960935|ref|NC_007146.2|:119292-122162 Haemophilus influenzae 86-028NP chromosome, complete genome
ATGGCATTATTCCAAGACGTGTTAGAGGCTTTCTTCCCTGCTAAAAAAGGTGATAAGCCTCAACCTAAAA
AGGAACCTATCCTAACATCCATTGCACCGGAAGAAGCACAGCAGGATGATACCAATAACGTAGAAGAGAC
GATTGAAATCACTCCTGTTATGCGTAATAGAAAAATGACCAGAGAGCAACATGTTAAAATGCTTTATGGG
CGCGATCCCTCTTTTATCTCCAATCTTCCTTATGCGGAATATTTGGAAGAAGAAGGCGTAATGCTTTTTG
ATGATGCTAAAAGTGCAGGTGCGGTATTTGATATTAAGCCTATAGGAACTGAGGGAAGAAGCAGCGACTA
TCTTAATCGCGTTCGCACATTGGTTAAAGATGCCTTACAGGATAGTTTCGATGAACTTGATACCAACCCT
TACGTTGTACAATTCTATTGCCAGGATGACAAGGATTTAAGCGGTTATGTTGAGAATCTGAGACAGTACA
TTAAAACCACTTCACCTGAAGCGAGCGGTAGTGAGTTTACAGAACAGTGGCTTGGTGAAATGGAGCGTCA
CTTAAAAGCAGTAGGTAAACCAGGTGGGCTTTTTGTTGATGACCGGGTAACAAATACGGCATGGGCTGGA
AAAGTGCGTAAAACACGCATGGTTATTTATCGTTATGCTGGAAATAATGAGACAGATACAATCGAGAAAT
TAAATACAGCTTGTGATCGTGTTCAAAGTGCTTTTATCACAGCTGGATTAACCATGGAACGCCAAAATGA
AACACAAATTCATCGTTGGTTATTAGAATGGTTTAATCCAAATCCATCACGCTATTTTAACGGACTCGAT
GATAAAGCTTGCTATGATCTTTTATCACTCTCTAAGGATGAATCTGCTCTACCATTACAAGACCAAGATT
TTAGTGAAAATCTCTTTTTTACGCCACCGGAAAGTAAAAATGGCTATTGGTATTTTAATGAGCAACCTCA
CGAAGTCATTGTAGTTGATAATATTCGTAAGCAGCCGGATGTTGGCCACATGACAGGCGAAGTCACTCGA
GGTCGTAATATTAATGCACTATTTGATTTATTGCCGGAATCAACCATTATGGCTATCACTGTAGTCATTC
ATCCTCAAGATAAATTACAGGCGCATTTAGACAAATTAAGTAGTCGAGCTGTCGGTAATAACTATGAGTC
TATCTATTTAAAACAAGATGCCCTCACAGTAACGGAATATTTAAAAGACGGACACAAGCTTTATCAAGCT
GGCATGGTTTTCTATGTAAGAGGGAAAGACGATCAAGAGCTACGCATTCGCTCAAGAGAATTAAGAACGG
TTTTACTCAGTAATAATTTAGTGCCGGTAAAAGAAGGCAACGAAGTTGCGCCTCTTAATAGCTATTTACG
CTGGCTACCGATGAATTTTAATCCTCAATTAGATGCAAAATCTCGTTTTTATACCAAATATTATTGGGTG
CAACACATTGCGAATATGTTACCTGTATTTGGCCGTGAGACCGGAACGGGACACCCAGGAATCACCTATT
TTAACCGCGGTGGAAGCCCATTAGATTTTGACCCACTAAACCCTAAAGACCGGACTAAAAATGCGCATAA
GCTCATTTTAGGCCCTACAGGTTCAGGTAAATCGGCAACATTAACCGCACAAATGGCACAACTGATGGCG
GTGCACCGTCCTCGCTTGTTTATTGTAGAAGCAGGTAACTCTTTTGGATTGTTTTCAGATTATGCGGAGC
GTTACGGTTTAACGGTTAACCGGGTATCTCTTGAGCCAAGTAGTAACATCGCTTTACCGCTCTTCTCTGA
AGCGCATCGTTTATTGGAAATGGATATCGATCTTGAAGTTCAAGATGATGACGATAATGAAGATGAAGGC
GAGGAACAACGAGACTTACTTGCGGAAATGGAATTAACCGCTCGCTTAATGATCACCGGGGGAGAAGCGA
AGGAAGATGAGAAAATGAGCCGTGCTGACCGCTCGGCTATTCGCCAGGCTATTTTATTAGCTGCAGAGAA
AACTTCACAAGAGACCCCACCTCGTCAAGTTTTAACCGGGGATGTAAAAGCCGCACTTGAGGAGTTAAGT
CGTCGCCAAGATATTCGCCCGGAACGTGCATCTCGTCTTGCAGATATGGCCGAAGCAATGGATATTTTCT
GCACTGGGGTAAATGGTCGATTCTTTAACCGTGAAGGGGAAATTTGGCCTGAAGCTGATATTACACTTGT
CGATTTGGCGATGTTTGCACGTGATGGCTATGAAGCTGAATTAGCGATTTCGTATATTTCCCTAATTAAC
CATATCAACTCATTAGGTGAAAAATATCAACACAGTTTCCGCCCTATCGTGAACATTACGGATGAGTCGC
ATATCATTACCGTAAATCCACTTCTAGCTAAGTTCCTGGTTAAAGGTTCTAAAATGTGGCGTAAATTGGG
TATTTGGTTATGGTTAGCTACACAGAATATGGCTGACTTCCCTGATGAATCTGATAAATTACTCAGCATG
GTTGAATGGTGGGAATTACTTAACCTTTCTAATGATGAAGTCGAACAGGTAAACCGTTTCCGTCGTTTAT
CCGAAGCTCAGAAAATGATGTTGTTATCTGCGAAAAAAGCAGATAAGAAATATACTGAAGGTGTGGTGCT
CGCAACCAATATGGAAGCCTTATTCCGTGTTGTTCCACCTAGTCTTTACTTAGCACTAGGGATGACTGAA
AAACACGAGAAAGCACAACGTAAACAATTAATGATGGAACATAACTGTACTGAGTTAGATGCGGCATTGA
TGGTTGCTAAAGACTTAGACAAAAAACGGGGGATTGCAGTCAATGACGAACTTAACTCAATCGCAGCCTA
A
 Primer design