SecReT4
Protein ID: 68248678
T4SS name [ID]Tfc [47]
Gene symbol-
Locus tagNTHI0145
StrainHaemophilus influenzae 86-028NP
Repliconchromosome [GenBank: NC_007146] [Browse all T4SS(s) in this replicon]
Location [Strand]130460..132460 [-]
Producthypothetical protein
Component typeTfc22
UniProt IDQ4QPB7
KEGG IDhit:NTHI0145
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 666 a.a.     [Download]
>gi|68248678|ref|YP_247790.1| hypothetical protein NTHI0145 [Haemophilus influenzae 86-028NP]
MKLNHALKASYIAISCAILSSTMPVSASNSNPFGFNKADSILSDMVFYQIGGGVGYMAPPSRGTIPAAEF
GIGWKANLMCGNFDIKTSIKNQLNGLTEGFKDLYSNVIESATGAVASLPAMVIQRANPQLYDILTNGLYQ
GKIDFNSLKTSCEEMSKKLADATLNGRWSQSSDMESFKDITSTEPDATRAKKRLEESQGKEGKEWVGGKK
RGGQGQEPIKIVEDVAKAGYNMQNKRNVLESGRISGSSCSGLLCQTWDNPKDMTDWLTNVIGEKQLTTCK
TDCGTASSSRAGVGLTPEIEKENIKTVTQLQKALNMSTPSVEVLAELSSTTVPVTRGLIESLREDPDAQV
LGQRLASEIAVAKTMEKMLLARRAVLTGMREPNVANNKDAQEELEKILTLIDREIGQIRMEIDLQKSLTG
NSAVAILQNKELREYNTGTGNVTRDSVDKRISDLANGTNSNAAELADADNINIPRNNVTLEVPQMSNSLS
YTGTGGTSGNSRGNTSYSSVPAIKGTALDQATGLLKKFEGFSDKAYWDVNAYRTGYGSDTITKADGTIVK
VTKDTVVSRADAERDLARRTQEFANRARNNVSSSTWDKLPPNAQAALTSYAYNYGSLTKDVIAAAQASAQ
SGDMNALANAVRNRQNNNNGVNAKRRNQEADYILGK
 
Nucleotide Sequence: 2001 bp     [Download]
>gi|162960935|ref|NC_007146.2|:c132460-130460 Haemophilus influenzae 86-028NP chromosome, complete genome
ATGAAATTAAATCATGCACTGAAAGCATCTTATATTGCTATATCGTGCGCAATCTTATCCTCAACCATGC
CAGTATCAGCTTCTAATAGTAATCCGTTTGGATTTAATAAAGCCGATTCTATTTTGTCTGATATGGTGTT
TTATCAAATTGGGGGCGGTGTAGGTTATATGGCTCCCCCGAGTCGAGGTACGATTCCTGCAGCTGAATTT
GGGATTGGTTGGAAAGCTAACTTGATGTGCGGTAATTTTGACATTAAGACGAGTATTAAAAATCAGTTAA
ATGGTTTAACTGAAGGATTTAAAGATCTTTATAGTAACGTTATCGAATCAGCCACAGGAGCTGTGGCGAG
TTTACCTGCAATGGTTATTCAACGAGCAAATCCTCAGTTATACGATATTCTTACGAATGGTTTATATCAA
GGTAAAATTGATTTTAATAGCTTAAAAACCAGCTGTGAAGAAATGTCTAAGAAGCTTGCAGACGCAACTT
TAAATGGTCGTTGGTCTCAAAGTTCGGATATGGAATCCTTTAAAGACATTACTTCAACTGAACCAGATGC
TACTCGAGCTAAAAAGAGACTTGAGGAATCTCAAGGTAAGGAAGGTAAAGAGTGGGTCGGGGGTAAAAAA
CGCGGTGGCCAAGGACAAGAACCAATCAAAATTGTTGAGGATGTTGCAAAAGCTGGCTACAACATGCAAA
ACAAGCGTAATGTATTAGAATCAGGTCGAATCTCCGGTAGTAGTTGTAGCGGATTACTTTGTCAAACTTG
GGATAATCCTAAAGATATGACAGATTGGTTAACGAATGTGATCGGTGAGAAGCAATTAACTACTTGTAAA
ACAGATTGTGGTACTGCTAGTAGCTCTCGAGCTGGTGTTGGTTTAACACCTGAAATTGAAAAAGAAAATA
TTAAGACGGTAACTCAATTACAAAAAGCGCTTAACATGAGCACTCCTTCCGTTGAAGTACTTGCAGAATT
AAGTTCTACAACAGTTCCTGTAACTCGTGGCTTAATTGAGTCTTTACGAGAAGATCCCGATGCTCAAGTA
TTAGGGCAGCGTTTAGCCAGTGAAATTGCTGTAGCTAAAACAATGGAGAAAATGCTTCTTGCACGTCGAG
CTGTTTTAACGGGTATGCGTGAGCCAAATGTGGCCAACAATAAAGATGCTCAAGAAGAGTTAGAAAAGAT
CCTCACTTTAATTGACCGAGAAATAGGTCAAATTAGAATGGAGATTGATCTACAAAAATCACTTACCGGG
AATTCCGCAGTTGCAATCCTACAAAATAAAGAGCTACGTGAATATAACACTGGAACCGGAAATGTTACAC
GTGACAGTGTAGATAAACGGATTAGCGATTTAGCTAATGGTACGAATAGCAATGCTGCTGAATTGGCAGA
TGCTGACAATATCAATATTCCTCGTAACAATGTCACTTTAGAAGTGCCTCAGATGTCAAACTCCCTGTCT
TACACCGGGACTGGCGGTACATCCGGAAATAGTAGAGGTAACACTTCTTATTCATCAGTTCCAGCAATTA
AAGGGACTGCACTTGATCAAGCTACAGGGTTGTTGAAAAAATTTGAAGGGTTTAGTGATAAAGCATATTG
GGATGTCAATGCTTATCGCACTGGATATGGTTCAGATACTATCACAAAAGCGGATGGTACAATTGTCAAA
GTAACGAAAGATACTGTAGTTAGTCGCGCTGACGCAGAGCGTGATTTAGCACGTCGAACACAAGAATTTG
CAAATAGAGCGAGAAATAACGTATCATCTTCAACATGGGATAAGTTACCGCCAAATGCCCAAGCCGCATT
AACATCTTATGCCTATAACTATGGCTCATTAACAAAAGATGTGATTGCTGCAGCCCAGGCATCTGCGCAA
TCAGGCGATATGAACGCACTAGCAAATGCAGTAAGAAATCGTCAAAACAATAATAATGGTGTAAATGCTA
AACGTCGTAACCAAGAAGCAGATTACATTTTAGGAAAATAA
 Primer design