SecReT4
Protein ID: 70732029
T4SS name [ID]Tfc [681]
Gene symbol-
Locus tagPFL_4693
StrainPseudomonas fluorescens Pf-5
Repliconchromosome [GenBank: NC_004129] [Browse all T4SS(s) in this replicon]
Location [Strand]5423444..5424187 [+]
Productintegrating conjugative element protein
Component typeTfc3
UniProt IDQ4K7K7
KEGG IDpfl:PFL_4693
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 247 a.a.     [Download]
>gi|70732029|ref|YP_261776.1| unnamed protein product [Pseudomonas fluorescens Pf-5]
MNLKILCTLACYLISTAYAATAPVAAGQASQLHFTAEGESSQRRLQDKAADAWGISAQEYERYQDVMQGP
RGVYSPGLDPLTALGIEARSEEERRRYAELQVKTERQRVEKELSYQRAYDEAFRRLYPNEKAIEISSATL
TTPTANSSPLLQGDGRLAIFVKDNCVACIDEVKKLQASQAPFDLYFVGSQGDDERIRRWAILAGVDPVNV
KSRRITLNHDQGRWLGLGLGGELPAAVKQVNGQWRRQ
 
Nucleotide Sequence: 744 bp     [Download]
>gi|70728250|ref|NC_004129.6|:5423444-5424187 Pseudomonas fluorescens Pf-5 chromosome, complete genome
ATGAATCTAAAGATTCTCTGCACCCTCGCGTGCTACCTGATCTCCACGGCTTACGCCGCAACAGCACCGG
TAGCTGCAGGCCAGGCATCACAGCTCCACTTCACCGCCGAAGGCGAATCATCACAGAGAAGGCTCCAGGA
CAAGGCAGCAGATGCGTGGGGGATCTCCGCCCAAGAGTACGAGCGGTACCAGGATGTGATGCAGGGGCCG
CGGGGGGTGTACTCGCCGGGGCTGGACCCGCTGACTGCCCTGGGTATCGAAGCCCGCTCTGAAGAGGAAC
GCCGGCGCTATGCGGAGCTGCAAGTAAAAACCGAGAGGCAACGTGTAGAAAAAGAGTTGTCGTATCAGCG
CGCATACGATGAAGCGTTCAGGAGGCTGTACCCGAACGAGAAAGCGATCGAAATCTCCTCGGCAACCCTG
ACCACTCCAACAGCAAACAGCTCACCGTTGCTGCAGGGAGACGGTCGCCTGGCGATCTTTGTGAAAGACA
ACTGCGTTGCGTGCATCGACGAAGTGAAGAAGCTACAAGCATCTCAGGCACCTTTCGACCTCTACTTCGT
CGGCAGCCAGGGCGATGACGAGCGCATCCGGCGATGGGCAATTCTCGCTGGCGTCGACCCTGTCAACGTC
AAGAGCCGACGAATCACCCTCAACCATGACCAAGGTCGCTGGCTCGGCCTTGGCCTGGGCGGTGAACTCC
CAGCGGCAGTAAAACAGGTGAATGGCCAATGGCGCCGTCAGTAA
 Primer design