SecReT4
Protein ID: 70732031
T4SS name [ID]Tfc [681]
Gene symbol-
Locus tagPFL_4697
StrainPseudomonas fluorescens Pf-5
Repliconchromosome [GenBank: NC_004129] [Browse all T4SS(s) in this replicon]
Location [Strand]5427701..5428450 [+]
Productintegrating conjugative element membrane protein
Component typeTfc8
UniProt IDQ4K7K3
KEGG IDpfl:PFL_4697
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 5.7e-67, Aligned region: 47..246
Protein Sequence: 249 a.a.     [Download]
>gi|70732031|ref|YP_261780.1| unnamed protein product [Pseudomonas fluorescens Pf-5]
MADDVSKKAQQQQERPESLISKIFWFPFNFLGVMFGSLIVAILVDWVCLYFFWPEAGWRHGQQMLTNELS
WLSQGLVHSAVVQEPGRTATWLVTGAYDWLIVKTGMLSWVQGMESIAHAGPRNDLDIRYMAAQSVTTVQN
YALAALFTVLVFCVRLVVLLMTIPLFAMAALTGLVDGLVRRDLRKFGAGRESSYLYHKARGTLIPLAILP
WTFYLALPISISPLLVLLPCAALLGVAVSITAASFKKYL
 
Nucleotide Sequence: 750 bp     [Download]
>gi|70728250|ref|NC_004129.6|:5427701-5428450 Pseudomonas fluorescens Pf-5 chromosome, complete genome
ATGGCAGATGACGTATCAAAGAAGGCTCAACAGCAACAGGAGCGACCAGAGTCGCTGATCAGCAAGATTT
TCTGGTTCCCCTTCAACTTCCTCGGGGTGATGTTCGGTTCTCTCATAGTCGCGATCCTGGTCGACTGGGT
ATGCCTCTACTTTTTCTGGCCAGAAGCTGGCTGGAGGCACGGGCAGCAAATGCTAACAAATGAGCTCAGT
TGGCTATCCCAGGGGCTGGTACACAGTGCCGTTGTGCAAGAACCCGGGCGCACAGCAACCTGGCTCGTTA
CAGGGGCCTATGACTGGCTGATCGTGAAGACTGGGATGCTCAGCTGGGTCCAGGGGATGGAGTCGATAGC
ACATGCCGGCCCACGCAACGACCTGGACATTCGATACATGGCAGCACAAAGCGTCACAACGGTGCAGAAC
TATGCTCTTGCAGCGCTGTTCACCGTCCTGGTGTTCTGTGTTCGTCTCGTTGTGTTGTTGATGACCATAC
CGCTGTTCGCTATGGCCGCACTCACAGGCCTGGTTGATGGCCTGGTCCGACGAGATCTCCGCAAATTCGG
TGCTGGCCGCGAGTCCAGCTACCTCTACCACAAGGCAAGGGGAACGCTCATTCCACTGGCCATTCTCCCA
TGGACCTTCTACCTGGCGCTTCCGATCAGCATCAGCCCGCTCCTGGTCCTACTCCCGTGTGCGGCGCTGC
TCGGCGTCGCAGTGAGTATCACTGCTGCCAGCTTCAAGAAATATCTTTGA
 Primer design