SecReT4
Protein ID: 70732036
T4SS name [ID]Tfc [681]
Gene symbol-
Locus tagPFL_4703
StrainPseudomonas fluorescens Pf-5
Repliconchromosome [GenBank: NC_004129] [Browse all T4SS(s) in this replicon]
Location [Strand]5431796..5432440 [+]
Productintegrating conjugative element protein
Component typeTfc12
UniProt IDQ4K7J7
KEGG IDpfl:PFL_4703
PDB IDNA
Domain hit(s) vs Pfam DUF2895 [PF11444], Evalue: 3e-87, Aligned region: 4..205
Protein Sequence: 214 a.a.     [Download]
>gi|70732036|ref|YP_261786.1| unnamed protein product [Pseudomonas fluorescens Pf-5]
MSFRKKVNAQEAHILSLRIALLLMTMIAAYMAYGWKTAPSDLTIHVPPDLRSGSTRKWWDVPPESVYAFG
FYIFQQMQRWPRDGEEDYLANISRLDGYLTPSCRDYLKKDYELRLNAGELRKRERSVSEIPGRGISDQSG
EHTSVKSINDWIVNLDLIADESVAGERVKRALARYPLHIIRSDTDPEKNPFGLLWNCYAGDPQRIEVSPA
GDKP
 
Nucleotide Sequence: 645 bp     [Download]
>gi|70728250|ref|NC_004129.6|:5431796-5432440 Pseudomonas fluorescens Pf-5 chromosome, complete genome
ATGAGTTTTCGTAAAAAAGTGAACGCTCAAGAGGCGCACATCCTTAGTCTGCGCATTGCGCTGCTTTTGA
TGACGATGATTGCCGCCTATATGGCCTACGGCTGGAAAACTGCACCTAGTGATCTGACCATCCACGTCCC
ACCAGATCTGCGTAGTGGCAGCACTCGAAAGTGGTGGGACGTCCCTCCTGAGAGCGTCTACGCCTTCGGA
TTCTACATTTTTCAGCAGATGCAGAGATGGCCGCGCGACGGTGAGGAAGACTATTTAGCGAATATCAGCA
GACTGGACGGCTATCTGACCCCCAGTTGCCGTGACTATCTGAAAAAAGACTACGAGTTAAGGCTGAATGC
TGGAGAACTCCGAAAACGCGAACGCAGCGTGTCGGAGATTCCTGGACGTGGGATCAGCGATCAGAGCGGT
GAACACACCAGCGTCAAGAGCATAAACGACTGGATTGTTAATCTCGATCTGATCGCTGACGAATCGGTCG
CTGGGGAACGGGTTAAGCGGGCACTCGCAAGATACCCTCTCCACATCATTCGATCTGATACCGACCCCGA
GAAAAACCCGTTTGGCCTCTTGTGGAACTGCTACGCGGGCGATCCTCAACGCATCGAAGTCTCCCCGGCA
GGAGATAAACCATGA
 Primer design