SecReT4
Protein ID: 70732037
T4SS name [ID]Tfc [681]
Gene symbol-
Locus tagPFL_4705
StrainPseudomonas fluorescens Pf-5
Repliconchromosome [GenBank: NC_004129] [Browse all T4SS(s) in this replicon]
Location [Strand]5433332..5434828 [+]
Productintegrating conjugative element protein
Component typeTfc14
UniProt IDQ4K7J5
KEGG IDpfl:PFL_4705
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 498 a.a.     [Download]
>gi|70732037|ref|YP_261788.1| unnamed protein product [Pseudomonas fluorescens Pf-5]
MNIQSNPLLKWLAVPFLVFAVVMFFTATKKGQVDHQDNNVVAIGSDEAQKLGVDGDTPGDTLRTVVTESK
ELRKQVAEMLKINNDQKSQNEELQKQLKDMDSKVENRLDNAKKELQDEVQNKSQGLIDSLQTQLNNLSNQ
PNATGGDLPIGFGVQPGDGKGFEQSPTTKDGLVWIEPRDATAVDANGKPLPLGSSQAASGFNFPTSFGPA
ANRGQNALEQIDQGLRPGNQQVDRETRKFVRKTYTLPQNSTLMGSVAMSALIGRVPIDGTVNDPFPFKIL
IGPDNLTANGIELPNVAGAVATGTASGDWTLSCVRGQVRSLTFVFNDGTVRTFPAPAEDADGNQNNNQAS
STDGKTIQGGLGWISDSYGVPCISGDRRSNAAEYLTNQSLVTAAGAGVAKLLKADESNNTTMFTGNGTSF
GTTGSSGNSAIGSILSGGVSDIRSWMNKLYGEAFAAVYVQPGAKVAVHLDQQLAIDYELKGRKVDYHSGA
NNVPAALD
 
Nucleotide Sequence: 1497 bp     [Download]
>gi|70728250|ref|NC_004129.6|:5433332-5434828 Pseudomonas fluorescens Pf-5 chromosome, complete genome
GTGAACATTCAAAGTAATCCCCTACTGAAGTGGCTTGCAGTGCCCTTTCTTGTCTTCGCTGTGGTGATGT
TCTTTACCGCAACAAAAAAGGGACAGGTGGATCACCAAGATAACAACGTCGTGGCCATCGGTTCCGATGA
GGCCCAAAAACTAGGTGTGGATGGCGATACACCAGGTGACACCCTTCGGACCGTAGTCACAGAAAGCAAG
GAGCTCAGGAAACAGGTGGCTGAGATGCTAAAGATCAACAACGATCAGAAGTCTCAGAACGAAGAGCTTC
AGAAGCAGCTGAAGGACATGGACTCAAAAGTTGAGAACCGTTTAGACAATGCAAAAAAAGAACTACAGGA
CGAGGTTCAGAACAAGAGCCAAGGCCTGATCGACTCTCTGCAAACTCAACTCAACAACCTCAGCAACCAA
CCTAACGCAACCGGGGGCGACCTTCCAATCGGGTTTGGTGTGCAGCCAGGTGACGGCAAAGGCTTCGAAC
AGTCTCCTACAACAAAGGACGGCCTTGTCTGGATTGAACCACGCGATGCCACTGCCGTTGACGCCAACGG
TAAACCGTTGCCCCTTGGCTCTAGTCAGGCTGCAAGCGGGTTCAACTTTCCTACCAGCTTCGGCCCGGCA
GCCAACAGAGGTCAGAATGCACTGGAACAGATCGATCAAGGCCTGCGTCCAGGAAATCAACAGGTCGACC
GTGAAACCAGGAAGTTTGTGCGCAAGACCTACACTTTGCCCCAGAACTCCACATTGATGGGATCAGTGGC
CATGTCGGCCCTGATCGGCCGGGTGCCAATTGATGGGACCGTCAACGACCCGTTTCCTTTCAAGATCCTG
ATTGGCCCAGACAACCTGACTGCGAACGGCATCGAGCTCCCCAACGTCGCTGGTGCAGTCGCAACAGGCA
CCGCCAGTGGCGACTGGACACTCTCATGTGTAAGAGGGCAGGTCCGCAGCCTGACGTTTGTCTTCAACGA
CGGCACTGTCAGGACCTTCCCGGCGCCGGCTGAAGACGCGGACGGCAACCAGAACAACAACCAGGCCAGC
AGTACAGATGGGAAGACCATTCAGGGTGGCCTTGGCTGGATCAGCGACTCCTACGGCGTTCCATGTATCT
CGGGTGATCGGCGCTCCAATGCGGCCGAATACTTGACTAATCAGTCGCTTGTTACTGCCGCCGGTGCCGG
CGTTGCGAAGCTGCTTAAAGCCGACGAGAGCAACAACACAACGATGTTTACCGGGAATGGCACCTCTTTC
GGCACCACCGGTTCATCAGGAAATTCCGCGATCGGGTCGATCTTGTCCGGAGGCGTAAGTGATATCCGCT
CCTGGATGAACAAGCTCTATGGCGAAGCATTTGCTGCTGTGTATGTACAGCCTGGCGCGAAGGTCGCCGT
ACACCTCGATCAGCAACTGGCGATCGACTATGAACTGAAAGGTCGCAAAGTCGACTACCACTCCGGAGCG
AATAATGTCCCAGCCGCGCTCGATTAA
 Primer design