SecReT4
Protein ID: 70732038
T4SS name [ID]Tfc [681]
Gene symbol-
Locus tagPFL_4706
StrainPseudomonas fluorescens Pf-5
Repliconchromosome [GenBank: NC_004129] [Browse all T4SS(s) in this replicon]
Location [Strand]5435245..5438169 [+]
Productconjugative transfer ATPase
Component typeTfc16
UniProt IDQ4K7J4
KEGG IDpfl:PFL_4706
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 2.2e-64, Aligned region: 68..345
AAA_10 [PF12846], Evalue: 5.5e-45, Aligned region: 539..877
Protein Sequence: 974 a.a.     [Download]
>gi|70732038|ref|YP_261789.1| unnamed protein product [Pseudomonas fluorescens Pf-5]
MGLFERLRDKLNLAVESDEQLTSEPIHLDLEQARERYLKRLQALGIPTPSEGSQPAKKSDVSKLYEVAPS
IVDLLPWVEYLPEEQAMLLEDGVSRAAFFELVPIGTEGREAEWLHLARDALENALQDSLDELESSPWVLQ
LYAQDETRWDEYRENLNKYVHPRVKDSEFTKLYLALFQRHLDAISKPGGLFEDTTVSKLPWRGQNRKVRL
VVYRRVKKQDLNVRGQDPGSYLKLICERLIGALANAGVVAKRLDEMGIQNWLIRWFNPYPDHLGDSDQDI
RRFYEQVCEPPRDLEAGELPLASGTDFSQNLFFREPLSDVDKGLWVFDGRPHRVVMLDRLKNPPKTGHLT
GEIRQADALNALFDRLPENTTLCITMVPTPQDLLEGHLEKLSKKAVGDTQASLHTRQDVETARTILGRKH
KLYRASVAFFLSGKDRVELDQRSTQLCNVLQAAGMHPVMPQDEVAPLNSYLRWLPCNFDPNERRAMDWYA
QLMFVQHIANLAPIWGRSTGTGHPGFTFFNRGGSPLTFDPFNRLDRQMNAHGFIFGPTGSGKSASLTNVI
CQMLAIYGPRMYVAEAGNSFGLLAQFAQNLGLSVHRVRLAPGSGVSLAPFADAIKLVQTPNLVKVLDADD
IEASDATSQRPDMEDEQRDILGEMEIIARLMITGGEEKEDERMTRADRSAIRQAILAAANTCMKAGRVVL
TQDVRDALYEASRNEGTPETRRNRLSEMAEAMDMFTMGADGEMFNREGTPWPEADLTVVDFATYAREGYA
AQLAIAYISMLNTVNNIAERDQYKGRPIVKITDEGHIITKHPLLLPYAMKITKMWRKLGAWFWLATQNID
DIPASGAPMLNMIEWWMCLNMPPDEVEKIANFRELTSAQKKMILSASKESGKFTEGVLLGKGKEFLFRVV
PPSLYLALAMTESEEKAQRFKIMQEQGCDELHAALQVAADLDRQRGIASFPIKFPENKAMEHQA
 
Nucleotide Sequence: 2925 bp     [Download]
>gi|70728250|ref|NC_004129.6|:5435245-5438169 Pseudomonas fluorescens Pf-5 chromosome, complete genome
ATGGGACTCTTCGAGCGCCTACGCGACAAACTCAACCTTGCGGTTGAGTCTGATGAACAACTCACAAGTG
AACCTATTCACCTTGATCTCGAACAAGCCCGGGAGCGCTACCTGAAGCGCCTGCAGGCGCTGGGAATCCC
CACTCCAAGTGAAGGGTCGCAACCAGCCAAAAAGAGCGATGTATCGAAGCTGTACGAAGTTGCTCCGTCG
ATTGTGGACCTATTGCCCTGGGTCGAATACTTACCTGAGGAGCAGGCCATGCTGCTCGAGGACGGGGTAT
CGCGCGCGGCATTCTTTGAACTTGTACCGATCGGGACCGAGGGTCGAGAAGCCGAATGGCTACATCTAGC
CAGGGACGCACTTGAAAATGCTCTGCAGGACAGCTTGGATGAGCTGGAAAGCTCGCCCTGGGTGCTCCAA
CTCTATGCTCAAGACGAAACACGCTGGGACGAGTACCGGGAAAATTTGAACAAGTACGTACATCCTCGAG
TGAAAGATAGTGAGTTCACCAAGCTCTACCTGGCCCTCTTTCAGCGTCACCTGGACGCGATTTCGAAACC
TGGTGGACTTTTCGAAGATACGACAGTCAGCAAGCTGCCATGGCGCGGTCAGAATCGTAAGGTTCGCCTG
GTCGTGTATCGTCGGGTGAAAAAACAAGATCTCAACGTGCGCGGCCAAGATCCTGGCTCCTACCTGAAAC
TGATCTGCGAGCGACTCATTGGCGCTCTGGCAAATGCCGGCGTCGTTGCAAAGCGACTGGACGAAATGGG
AATCCAAAATTGGTTGATCCGTTGGTTCAATCCATACCCCGACCATTTAGGCGATAGTGACCAGGACATT
CGCCGGTTCTACGAACAAGTATGTGAGCCGCCCCGAGACCTCGAGGCCGGTGAGCTTCCTTTAGCCAGCG
GCACTGATTTTTCGCAGAACCTTTTTTTCAGAGAGCCGCTGTCAGACGTTGATAAAGGCCTGTGGGTTTT
CGATGGAAGACCACATCGAGTAGTGATGCTCGACCGGTTGAAGAACCCGCCTAAGACCGGTCATCTAACG
GGTGAAATTAGACAAGCAGATGCGCTCAATGCCCTATTTGACCGTCTACCTGAGAACACAACACTTTGCA
TCACCATGGTGCCGACACCCCAGGACCTTCTCGAGGGGCACCTCGAGAAGCTATCAAAGAAAGCCGTTGG
TGATACACAGGCCTCCCTGCACACACGGCAAGACGTTGAAACTGCTCGCACCATCCTTGGTCGCAAGCAC
AAACTTTATCGCGCCAGCGTGGCCTTCTTTCTGAGCGGCAAAGACAGAGTAGAGCTGGATCAGCGATCAA
CTCAGCTCTGTAACGTACTGCAAGCTGCTGGAATGCACCCCGTGATGCCGCAAGATGAAGTCGCACCTCT
TAACAGCTATCTGCGCTGGTTGCCTTGCAACTTCGATCCGAACGAACGTCGAGCCATGGACTGGTACGCC
CAGCTAATGTTCGTCCAGCATATTGCGAATCTGGCCCCCATCTGGGGCCGCTCGACAGGAACCGGCCACC
CTGGATTCACATTTTTCAACCGCGGCGGTTCGCCTCTCACTTTCGATCCTTTTAACCGGCTTGACCGGCA
GATGAACGCCCATGGCTTTATTTTCGGCCCAACCGGATCAGGTAAATCCGCATCCCTTACAAACGTGATC
TGCCAGATGCTTGCGATTTACGGTCCTCGGATGTACGTCGCCGAGGCCGGTAACAGCTTCGGTTTACTGG
CACAGTTCGCACAAAACTTGGGGCTGTCGGTTCATAGAGTGCGCTTAGCGCCAGGTTCCGGCGTGAGTCT
TGCCCCGTTCGCAGATGCCATCAAACTGGTCCAGACCCCAAACTTGGTCAAAGTCCTCGATGCGGACGAC
ATCGAGGCCTCCGACGCCACTTCACAGCGCCCAGATATGGAAGATGAGCAGCGGGACATCCTCGGCGAAA
TGGAGATCATTGCTCGTTTAATGATCACTGGCGGCGAGGAAAAAGAAGATGAACGCATGACCAGGGCCGA
CCGAAGCGCCATCCGACAAGCAATTCTTGCCGCTGCCAATACCTGCATGAAGGCGGGGCGCGTGGTGTTG
ACCCAGGATGTGCGTGATGCCCTGTACGAGGCCTCTCGTAACGAAGGAACCCCCGAAACTAGGCGAAACC
GGCTTTCGGAAATGGCTGAGGCGATGGATATGTTCACCATGGGTGCGGACGGAGAGATGTTCAACCGCGA
AGGCACCCCATGGCCTGAAGCGGACCTGACTGTCGTTGATTTCGCAACCTACGCTCGCGAAGGCTATGCG
GCCCAGCTTGCGATCGCTTACATCTCAATGCTCAACACCGTGAACAACATTGCCGAACGCGATCAGTACA
AAGGGCGCCCGATCGTCAAAATCACTGACGAAGGCCACATCATCACTAAGCATCCCCTATTGCTCCCCTA
TGCCATGAAGATCACGAAAATGTGGCGAAAGCTCGGTGCTTGGTTCTGGCTAGCAACACAAAACATCGAT
GACATCCCAGCCTCCGGTGCCCCTATGCTCAACATGATTGAGTGGTGGATGTGCCTCAACATGCCGCCCG
ATGAGGTCGAGAAAATTGCAAATTTCCGCGAGCTCACGTCAGCACAGAAAAAAATGATCCTTTCTGCAAG
TAAGGAGAGCGGGAAATTCACCGAAGGTGTGCTTCTGGGCAAAGGCAAAGAGTTCCTCTTCCGTGTTGTA
CCACCGAGCCTGTATCTCGCCCTTGCCATGACCGAAAGTGAAGAAAAGGCCCAGCGCTTCAAGATCATGC
AAGAGCAGGGATGCGATGAGCTTCATGCAGCACTTCAAGTAGCCGCGGATCTCGATCGGCAGCGCGGTAT
CGCATCGTTCCCCATCAAATTTCCTGAAAACAAGGCCATGGAGCATCAGGCATGA
 Primer design