SecReT4
Protein ID: 70732041
T4SS name [ID]Tfc [681]
Gene symbol-
Locus tagPFL_4712
StrainPseudomonas fluorescens Pf-5
Repliconchromosome [GenBank: NC_004129] [Browse all T4SS(s) in this replicon]
Location [Strand]5444784..5446316 [+]
Producthypothetical protein
Component typeTfc19
UniProt IDQ4K7I8
KEGG IDpfl:PFL_4712
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 1.2e-128, Aligned region: 10..490
Protein Sequence: 510 a.a.     [Download]
>gi|70732041|ref|YP_261795.1| unnamed protein product [Pseudomonas fluorescens Pf-5]
MTLYTNDYLEFYLTLVGWLINNGIWDMISDTGLFALPFLIIVVREWIKVRQEGADEGNKGVLSLARIETQ
LYIGYVVVSLCAIPVMSVGFDTLQFDQTRAKQCQVLLPAPGDTGWNTTFSSLTGKSARIPIWWAVMHSLS
KGLNSGAVAAIPCGTDLRQMRMDVDAIRIDNPLLAQEVADFTHDCFGPSRARLFMRQPDLGAITKDPKTL
QDLNWIGSRFLLNTSGYYDTDYSKTPRTAWPYDAKRDDGLPQVTGGGGYPTCKQWWSDGSIGLRDRLQAQ
VDPTLMNKLLGWAKWLSKDEVTDSMIRQVVSPSSQVNGDVYSDYGGQIGGTMWNGLARAGGTLGVGVGSL
AYFPGMDIVRQALPMVMAFLKMAMVICLPLVLIIGAYQLKVAMTMSVVFFALIFVDFWFQLARWVDSTII
DVLYGSGSPHLSFDPVMGLNTTTQDAILNFVMGAMFIILPLFWMSALAWAGVQVSGVLEGLSRGTQSVER
AGASGGGIAQQAVGSIGGKS
 
Nucleotide Sequence: 1533 bp     [Download]
>gi|70728250|ref|NC_004129.6|:5444784-5446316 Pseudomonas fluorescens Pf-5 chromosome, complete genome
ATGACCCTCTACACGAACGACTACCTGGAGTTTTACCTGACGCTGGTCGGCTGGCTGATCAACAACGGCA
TCTGGGACATGATCTCTGATACCGGCCTATTCGCTCTCCCCTTCTTGATCATCGTCGTGAGGGAATGGAT
CAAGGTTCGCCAGGAAGGTGCAGATGAAGGCAACAAGGGCGTCTTGTCGCTGGCCAGGATTGAGACCCAG
CTATACATCGGTTACGTGGTTGTTTCTCTGTGCGCGATCCCAGTGATGAGTGTGGGATTCGACACCCTGC
AGTTCGACCAGACTAGGGCTAAGCAATGCCAGGTACTGCTGCCAGCCCCTGGGGATACCGGATGGAACAC
CACCTTCAGTTCGCTGACCGGCAAGAGCGCAAGGATCCCGATCTGGTGGGCTGTGATGCACTCGCTGAGT
AAGGGCCTGAATAGCGGAGCGGTAGCGGCGATCCCCTGCGGTACCGATCTTAGGCAGATGCGGATGGATG
TCGACGCAATCCGGATTGATAACCCCTTGCTTGCTCAAGAAGTGGCTGACTTTACACACGACTGCTTCGG
CCCTTCCCGGGCGCGCCTCTTCATGCGTCAGCCGGATCTCGGGGCAATCACGAAGGACCCCAAAACCCTG
CAGGACCTCAACTGGATCGGTTCACGCTTCCTGTTGAATACATCTGGCTATTACGACACGGACTACTCCA
AGACTCCTCGCACAGCATGGCCATACGACGCGAAACGAGACGACGGGCTGCCCCAGGTCACCGGAGGTGG
AGGCTATCCCACATGCAAGCAATGGTGGTCGGACGGCAGCATTGGTCTCCGAGATCGCCTGCAGGCGCAG
GTCGATCCAACCTTGATGAACAAGCTTCTTGGCTGGGCGAAATGGCTGTCTAAGGACGAAGTCACGGACT
CGATGATTCGACAGGTCGTCTCACCGTCCAGCCAGGTGAATGGAGACGTGTACTCTGATTATGGTGGCCA
GATCGGCGGGACAATGTGGAACGGGCTAGCTCGCGCCGGCGGAACACTCGGAGTTGGGGTGGGCTCACTG
GCGTACTTCCCGGGGATGGATATAGTTCGTCAGGCGCTGCCCATGGTGATGGCCTTCCTCAAGATGGCAA
TGGTGATCTGCCTGCCCCTGGTACTGATCATTGGTGCCTACCAACTGAAAGTTGCGATGACCATGTCAGT
GGTGTTCTTCGCGTTGATTTTTGTCGACTTTTGGTTCCAACTGGCACGCTGGGTCGATAGCACCATCATT
GACGTACTCTACGGTTCTGGTTCACCACACCTTTCGTTTGACCCGGTTATGGGGCTCAACACAACCACTC
AAGATGCAATCCTTAACTTCGTCATGGGGGCCATGTTCATCATACTACCGCTCTTCTGGATGTCGGCACT
TGCGTGGGCAGGTGTACAAGTCAGCGGAGTTCTTGAGGGTCTTTCACGGGGAACACAATCAGTGGAGAGG
GCAGGAGCAAGCGGCGGCGGGATCGCCCAACAGGCAGTCGGGTCTATTGGAGGAAAAAGCTAA
 Primer design