SecReT4
Protein ID: 70734380
T4SS name [ID]Tfc [681]
Gene symbol-
Locus tagPFL_4695
StrainPseudomonas fluorescens Pf-5
Repliconchromosome [GenBank: NC_004129] [Browse all T4SS(s) in this replicon]
Location [Strand]5424720..5425226 [+]
Productintegrating conjugative element protein
Component typeTfc5
UniProt IDQ4K7K5
KEGG IDpfl:PFL_4695
PDB IDNA
Domain hit(s) vs Pfam DUF2859 [PF11072], Evalue: 1.1e-48, Aligned region: 29..165
Protein Sequence: 168 a.a.     [Download]
>gi|70734380|ref|YP_261778.1| unnamed protein product [Pseudomonas fluorescens Pf-5]
MTSFLRAAPVLLAMLAAGTVQASSKLIVVQDHGGVSALPYYQDLNLVPESGPPPLKGLLSGGAYPVKTPE
MTPGAVVGRTINAPGLQPLFLIGDDPMSRAWLTQHLQQLQQLQAVGLVVNVTSAARLDEIRRLAPGLQLE
PTSASDIANRLGLKNYPVLITSTTIRQQ
 
Nucleotide Sequence: 507 bp     [Download]
>gi|70728250|ref|NC_004129.6|:5424720-5425226 Pseudomonas fluorescens Pf-5 chromosome, complete genome
ATGACGAGTTTTCTGAGGGCTGCTCCAGTCCTGCTTGCAATGCTTGCAGCCGGCACGGTGCAAGCCAGTT
CCAAACTCATAGTTGTCCAGGACCACGGTGGGGTTTCAGCCCTGCCCTACTACCAGGACCTCAACCTGGT
ACCAGAGTCGGGTCCCCCACCACTCAAAGGACTCCTAAGCGGTGGGGCCTATCCCGTCAAAACTCCAGAG
ATGACGCCAGGGGCGGTAGTAGGCAGGACAATCAATGCCCCTGGCCTGCAACCTCTTTTTCTCATCGGTG
ACGACCCGATGTCACGAGCATGGCTGACACAGCACCTGCAGCAGCTGCAGCAACTGCAAGCAGTAGGGCT
AGTAGTCAACGTCACCTCAGCCGCTCGGCTCGACGAGATCAGGCGTTTGGCGCCCGGATTACAACTTGAA
CCGACATCTGCAAGCGATATCGCCAACCGGCTAGGGCTGAAGAACTACCCGGTACTGATCACCTCAACAA
CCATTCGACAGCAGTAA
 Primer design