SecReT4
Protein ID: 70734381
T4SS name [ID]Tfc [681]
Gene symbol-
Locus tagPFL_4694
StrainPseudomonas fluorescens Pf-5
Repliconchromosome [GenBank: NC_004129] [Browse all T4SS(s) in this replicon]
Location [Strand]5424172..5424723 [+]
Producthypothetical protein
Component typeTfc4
UniProt IDQ4K7K6
KEGG IDpfl:PFL_4694
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 183 a.a.     [Download]
>gi|70734381|ref|YP_261777.1| unnamed protein product [Pseudomonas fluorescens Pf-5]
MAPSVMRTYWILLLLCSQAMAAEDPPPAYKAIAIAHGVPAVVLYSVALQESGTKLRGQIVPWPWTLNVAG
TGYRFATRIDACRALNIAIATAGPARVDVGLGQTNIHANGHRYSSPCEGLDPYKNLNVTAEILAEHKAKG
GNWFDAAGRYHRPAGGAPAAKYRAAFAKHLSRVTGINFLVNNQ
 
Nucleotide Sequence: 552 bp     [Download]
>gi|70728250|ref|NC_004129.6|:5424172-5424723 Pseudomonas fluorescens Pf-5 chromosome, complete genome
ATGGCGCCGTCAGTAATGAGGACCTACTGGATCCTGTTGCTGCTATGCAGCCAGGCAATGGCCGCTGAGG
ATCCTCCACCTGCTTACAAGGCGATTGCGATCGCCCACGGAGTACCAGCCGTGGTGCTGTATTCCGTTGC
GCTGCAAGAGAGCGGTACCAAACTTCGAGGACAGATTGTGCCTTGGCCTTGGACGCTGAATGTGGCCGGT
ACCGGCTACCGATTCGCTACCCGGATCGATGCATGCAGGGCGCTGAATATTGCTATCGCAACTGCTGGTC
CGGCGAGAGTCGACGTAGGCCTTGGTCAGACGAACATCCACGCTAACGGCCATCGCTATAGCTCCCCGTG
CGAAGGGCTCGACCCCTACAAAAACCTGAACGTCACCGCAGAGATCTTGGCTGAACACAAAGCCAAGGGT
GGCAATTGGTTTGACGCGGCGGGCCGCTACCACCGCCCTGCTGGTGGCGCGCCTGCAGCCAAATACAGAG
CGGCTTTCGCGAAGCACCTAAGCCGAGTTACAGGCATAAACTTCTTGGTGAACAATCAATGA
 Primer design