SecReT4
Protein ID: 70734382
T4SS name [ID]Tfc [681]
Gene symbol-
Locus tagPFL_4704
StrainPseudomonas fluorescens Pf-5
Repliconchromosome [GenBank: NC_004129] [Browse all T4SS(s) in this replicon]
Location [Strand]5432437..5433348 [+]
Productintegrating conjugative element protein
Component typeTfc13
UniProt IDQ4K7J6
KEGG IDpfl:PFL_4704
PDB IDNA
Domain hit(s) vs Pfam DUF3438 [PF11920], Evalue: 5.7e-120, Aligned region: 7..300
Protein Sequence: 303 a.a.     [Download]
>gi|70734382|ref|YP_261787.1| unnamed protein product [Pseudomonas fluorescens Pf-5]
MNLRLRLGLWLAGTALLVTTSAEAVEIMQWERIPLAVPLHVGEERIVFVDQNVRVGIPPNIAGSLRVQSV
GGAIYFRASEEIPPTRLQLQNVATGEIMLVDIAATAPKPGQASLEPAKIVTGDSIAGRRYGQTAKTSTPG
SARSQTPPPAEEEAEEEPRHETPSTVALTRYAAQMLYAPLRTIEPVAGIQPVRVDRKIDLSTLLPTLPVE
AVAIGAWQLDNTFVTAIKLRNMSPQQLTLNPRDLLGSFATATYQHPYLGPRGNPSDTTTLYLVTQGKGLK
HSLLPSSVNQIDPKMGGEREHSK
 
Nucleotide Sequence: 912 bp     [Download]
>gi|70728250|ref|NC_004129.6|:5432437-5433348 Pseudomonas fluorescens Pf-5 chromosome, complete genome
ATGAACCTACGTCTGCGGTTAGGTCTGTGGTTAGCTGGCACTGCTCTCCTGGTAACGACCAGCGCGGAGG
CGGTTGAGATCATGCAGTGGGAGCGTATACCTCTTGCCGTTCCACTTCACGTTGGAGAAGAAAGGATCGT
CTTTGTCGACCAGAACGTTCGCGTCGGCATCCCTCCAAACATCGCCGGCAGCCTTCGTGTACAAAGCGTT
GGTGGGGCCATCTACTTTCGAGCAAGCGAAGAGATCCCGCCTACACGACTCCAACTGCAAAATGTCGCTA
CAGGCGAAATCATGCTTGTAGACATTGCAGCCACAGCACCTAAACCCGGCCAGGCCTCACTTGAGCCAGC
AAAGATCGTCACAGGTGACAGCATTGCTGGGAGGCGTTATGGCCAAACCGCCAAAACAAGCACTCCTGGT
TCAGCTCGATCTCAAACACCTCCACCCGCTGAGGAAGAGGCAGAGGAAGAGCCTCGTCATGAGACACCTT
CTACCGTCGCACTAACGCGATATGCAGCCCAAATGCTGTATGCACCTCTGCGTACTATTGAGCCCGTCGC
CGGAATCCAGCCGGTACGGGTGGACCGGAAAATAGATCTGAGCACTCTACTTCCAACTCTGCCTGTTGAA
GCTGTAGCCATAGGAGCCTGGCAGCTCGACAACACATTTGTGACGGCAATCAAGCTGCGCAACATGAGCC
CCCAACAACTGACCCTAAACCCAAGAGACCTCCTAGGCAGCTTTGCAACAGCCACATACCAGCACCCCTA
CCTCGGGCCTCGGGGAAATCCTTCTGATACCACAACTCTGTACCTGGTCACCCAGGGTAAAGGGCTCAAA
CATTCGTTGCTTCCAAGTTCGGTAAACCAGATTGATCCGAAGATGGGGGGTGAACGTGAACATTCAAAGT
AA
 Primer design