SecReT4
Protein ID: 70734383
T4SS name [ID]Tfc [681]
Gene symbol-
Locus tagPFL_4700
StrainPseudomonas fluorescens Pf-5
Repliconchromosome [GenBank: NC_004129] [Browse all T4SS(s) in this replicon]
Location [Strand]5430458..5430811 [+]
Productintegrative conjugative element protein
Component typeTfc9
UniProt IDQ4K7K0
KEGG IDpfl:PFL_4700
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 5.7e-30, Aligned region: 34..110
Protein Sequence: 117 a.a.     [Download]
>gi|70734383|ref|YP_261783.1| unnamed protein product [Pseudomonas fluorescens Pf-5]
MNRDLISTSTSRSSMTALAMIVAGGIAVSPVVEAATASEQTNIEVMVRQLNALEDSARRSSVIAGEPGQR
YYFDYDRLAADIQRIRQGLQAYLTPSRAQPRDAADLSGQYTTGGKRQ
 
Nucleotide Sequence: 354 bp     [Download]
>gi|70728250|ref|NC_004129.6|:5430458-5430811 Pseudomonas fluorescens Pf-5 chromosome, complete genome
GTGAACCGCGATCTAATTTCGACATCTACAAGCCGCTCATCGATGACAGCGCTGGCCATGATCGTTGCTG
GCGGTATTGCAGTCAGTCCGGTAGTGGAAGCCGCTACAGCATCTGAGCAAACCAACATCGAAGTCATGGT
CAGGCAGCTCAATGCCCTTGAGGACTCTGCGCGGCGTAGTAGCGTCATCGCAGGTGAACCAGGCCAACGC
TACTACTTCGACTATGACCGCCTGGCGGCAGACATCCAGCGGATCCGCCAAGGCCTCCAGGCTTACCTCA
CCCCAAGTCGTGCCCAACCTCGAGACGCCGCAGACCTCTCCGGTCAGTACACCACCGGAGGGAAGAGGCA
ATGA
 Primer design