SecReT4
Protein ID: 70734385
T4SS name [ID]Tfc [681]
Gene symbol-
Locus tagPFL_4710
StrainPseudomonas fluorescens Pf-5
Repliconchromosome [GenBank: NC_004129] [Browse all T4SS(s) in this replicon]
Location [Strand]5442113..5443051 [+]
Productintegrating conjugative element protein
Component typeTfc23
UniProt IDQ4K7J0
KEGG IDpfl:PFL_4710
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 3.5e-94, Aligned region: 26..300
Protein Sequence: 312 a.a.     [Download]
>gi|70734385|ref|YP_261793.1| unnamed protein product [Pseudomonas fluorescens Pf-5]
MRSRTLAFALTALTSFSASAAINTAAIVGSTASPTCLDYRVVGICYWLLCTPFGCKIKTSTKVRHYVPDA
VVSAYANTGENPWVEVSPMGRPNSTAQAGNNGTTNHNAENNISKFKNADVIGHPGGAVFSKFAAASGYAC
PGATLPFVPYMLSTLDTLAWRHGIPEVVYPESLMPGLREVGGLLSTNMWGSIYPRSGFIHQSDDFKAAAV
IAQRAGDITTRLGQPHVYVPMRTFPMPGYWPAGELLEDDYSTGKWQQLTPSLSPTCATFPTSGWGIGTDM
EAANGAYAWALWRPYSCCQRRGQIFLGSTDFQ
 
Nucleotide Sequence: 939 bp     [Download]
>gi|70728250|ref|NC_004129.6|:5442113-5443051 Pseudomonas fluorescens Pf-5 chromosome, complete genome
ATGAGATCTCGCACCTTGGCATTCGCGCTGACTGCGCTCACTTCATTTTCAGCATCGGCCGCAATCAACA
CGGCAGCAATCGTGGGGTCTACAGCCTCCCCGACCTGCCTTGATTACCGGGTTGTTGGGATCTGTTACTG
GCTCCTTTGCACGCCATTCGGATGCAAGATCAAAACTTCAACGAAGGTACGCCACTACGTGCCCGACGCC
GTTGTCTCGGCATACGCCAATACTGGCGAAAACCCATGGGTGGAAGTCAGCCCGATGGGGAGGCCGAATT
CCACCGCGCAAGCTGGGAACAACGGAACAACGAATCACAACGCCGAAAACAACATCTCGAAGTTCAAAAA
CGCTGACGTAATCGGGCACCCAGGTGGGGCTGTTTTCAGCAAGTTTGCAGCCGCTTCTGGCTACGCATGC
CCAGGCGCCACCCTCCCCTTCGTTCCGTACATGCTCAGTACCCTCGATACCCTTGCATGGCGCCACGGAA
TCCCCGAAGTCGTCTATCCAGAGTCCCTGATGCCTGGTCTGAGGGAAGTTGGCGGCCTTCTATCAACGAA
TATGTGGGGAAGCATCTATCCGCGCAGCGGATTCATTCACCAGAGCGACGACTTCAAGGCAGCAGCGGTG
ATCGCTCAACGTGCCGGCGATATCACAACCCGTTTGGGCCAACCGCACGTCTACGTGCCAATGCGGACCT
TCCCAATGCCTGGCTACTGGCCTGCCGGCGAACTCCTCGAGGACGACTACTCGACCGGAAAGTGGCAGCA
GCTCACACCTTCCCTGAGCCCAACTTGCGCAACATTTCCTACCAGCGGGTGGGGAATAGGCACCGATATG
GAAGCGGCCAACGGAGCCTATGCCTGGGCCCTCTGGCGCCCCTACTCGTGCTGCCAACGGCGCGGGCAGA
TTTTCCTCGGCAGCACTGACTTTCAATAA
 Primer design