SecReT4
Protein ID: 70734386
T4SS name [ID]Tfc [681]
Gene symbol-
Locus tagPFL_4709
StrainPseudomonas fluorescens Pf-5
Repliconchromosome [GenBank: NC_004129] [Browse all T4SS(s) in this replicon]
Location [Strand]5441688..5442116 [+]
Productintegrating conjugative element protein
Component typeTfc24
UniProt IDQ4K7J1
KEGG IDpfl:PFL_4709
PDB IDNA
Domain hit(s) vs Pfam DUF1525 [PF07511], Evalue: 7.5e-39, Aligned region: 27..139
Protein Sequence: 142 a.a.     [Download]
>gi|70734386|ref|YP_261792.1| unnamed protein product [Pseudomonas fluorescens Pf-5]
MLNAPLLARLQAATIICGSLALGNAHAEAWVVTDSAHPLIIPPGVEIRVILLDDQERLENQLSRNLPPSP
QQAAIAAQRMVKSPEGVRLMEELAKVQQGLTDVWSAGVEKIPAVVVDRKYVVYGQPDVANALKVIERSRG
QQ
 
Nucleotide Sequence: 429 bp     [Download]
>gi|70728250|ref|NC_004129.6|:5441688-5442116 Pseudomonas fluorescens Pf-5 chromosome, complete genome
ATGCTCAACGCCCCTCTTCTGGCCAGGCTGCAAGCCGCCACCATCATCTGCGGATCACTAGCACTCGGAA
ACGCTCACGCTGAAGCCTGGGTAGTAACCGACTCCGCTCATCCACTGATAATTCCTCCAGGCGTTGAGAT
TCGCGTCATTTTGCTCGATGACCAGGAGCGCCTGGAGAATCAGCTATCACGTAACCTCCCCCCCAGTCCC
CAACAAGCGGCAATTGCTGCACAGCGGATGGTGAAGAGTCCGGAAGGCGTGCGCCTTATGGAGGAGTTGG
CAAAGGTCCAGCAGGGGCTGACTGATGTTTGGAGCGCCGGCGTTGAGAAGATCCCGGCTGTAGTAGTCGA
CCGAAAGTATGTTGTCTATGGTCAACCTGACGTCGCCAATGCCTTGAAAGTCATCGAGCGCTCGAGGGGG
CAGCAATGA
 Primer design