SecReT4
Protein ID: 71558976
T4SS name [ID]VirB [203]
Gene symbol-
Locus tagpF1947_18
StrainHaemophilus influenzae biotype aegyptius plasmid pF1947 (NC_007206)
Repliconplasmid pF1947 [GenBank: NC_007206] [Browse all T4SS(s) in this replicon]
Location [Strand]15407..15562 [+]
ProductTraN/VirB7-like protein
Component typeVirB7
UniProt IDQ8VRD2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 51 a.a.     [Download]
>gi|71558976|ref|YP_271710.1| TraN/VirB7-like protein [Haemophilus influenzae biotype aegyptius]
MKTLFLIITTSLLLSACSSPPQPNEPKGKWYQINSSHYYEENANKTITTKP
 
Nucleotide Sequence: 156 bp     [Download]
>gi|71558958|ref|NC_007206.1|:15407-15562 Haemophilus influenzae biotype aegyptius plasmid pF1947, complete sequence
ATGAAAACTCTATTTTTAATTATAACCACATCATTGTTACTTTCGGCTTGTAGCTCACCGCCGCAACCGA
ATGAGCCTAAAGGAAAGTGGTATCAAATCAACAGCTCTCACTACTACGAAGAGAACGCTAACAAAACAAT
CACAACAAAGCCGTAA
 Primer design