SecReT4
Protein ID: 71558977
T4SS name [ID]VirB [203]
Gene symbol-
Locus tagpF1947_19
StrainHaemophilus influenzae biotype aegyptius plasmid pF1947 (NC_007206)
Repliconplasmid pF1947 [GenBank: NC_007206] [Browse all T4SS(s) in this replicon]
Location [Strand]15576..16349 [+]
ProductTraE/VirB8-like protein
Component typeVirB8
UniProt IDQ4L0T3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 3.6e-59, Aligned region: 42..251
Protein Sequence: 257 a.a.     [Download]
>gi|71558977|ref|YP_271711.1| TraE/VirB8-like protein [Haemophilus influenzae biotype aegyptius]
MKIFNRSKPKLLNENVEALAEEPTPAERKIVNERAKEHFKRKQEFEKDRVGFYKTLSKVGFGVGGIGALI
GLAGVIAVAGLTPLKTSEPYVIRVDNNTGFTDIVKPISDSSQTTYGEELDKYWLSKFIIERESYDWQLVQ
NSYDSVELMTTPQVFNEYKAYITSKVSPVNLLQQNKKIKVRVLSVSFINGIGQVRFSKQVLTASGDPDSV
IPTTYWLASIPFDYKHDIKLEQQRLINPLGFQALSYRADPESNLSEK
 
Nucleotide Sequence: 774 bp     [Download]
>gi|71558958|ref|NC_007206.1|:15576-16349 Haemophilus influenzae biotype aegyptius plasmid pF1947, complete sequence
ATGAAAATTTTTAACCGTTCTAAACCAAAATTATTAAATGAGAACGTGGAAGCGTTGGCTGAAGAGCCAA
CGCCAGCCGAAAGAAAAATCGTAAATGAAAGAGCCAAAGAACACTTTAAACGTAAACAAGAGTTTGAGAA
AGATCGTGTTGGTTTTTACAAAACACTTTCAAAAGTTGGTTTTGGTGTCGGTGGCATAGGGGCATTAATT
GGTCTTGCAGGCGTAATTGCCGTTGCAGGTCTTACTCCATTAAAAACATCGGAGCCGTATGTAATCCGTG
TCGATAACAATACAGGCTTTACCGATATTGTTAAACCTATTTCTGATAGTTCCCAAACCACATACGGCGA
GGAGTTAGACAAATATTGGCTCTCGAAGTTCATTATTGAACGAGAATCTTATGATTGGCAGCTCGTGCAA
AATTCGTATGACTCAGTAGAGCTGATGACAACGCCTCAAGTATTTAACGAATATAAGGCTTACATCACAA
GTAAAGTATCTCCAGTAAATTTATTACAACAAAACAAGAAAATTAAAGTGCGTGTACTTTCTGTTTCATT
TATTAACGGTATCGGTCAAGTCAGATTCTCAAAACAAGTTTTGACGGCAAGCGGTGATCCTGATTCCGTT
ATCCCTACGACTTATTGGCTTGCTTCAATTCCTTTTGACTATAAGCACGACATCAAGCTTGAGCAGCAAC
GTTTAATCAATCCATTAGGATTTCAGGCTTTAAGCTATCGTGCTGACCCTGAAAGTAATTTGAGTGAGAA
ATAG
 Primer design