SecReT4
Protein ID: 71558980
T4SS name [ID]VirB [203]
Gene symbol-
Locus tagpF1947_22
StrainHaemophilus influenzae biotype aegyptius plasmid pF1947 (NC_007206)
Repliconplasmid pF1947 [GenBank: NC_007206] [Browse all T4SS(s) in this replicon]
Location [Strand]18312..19376 [+]
ProductTraG/VirB11-like protein
Component typeVirB11
UniProt IDQ4L0T0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 6.9e-52, Aligned region: 28..331
Protein Sequence: 354 a.a.     [Download]
>gi|71558980|ref|YP_271714.1| TraG/VirB11-like protein [Haemophilus influenzae biotype aegyptius]
MTHFENEEIESTADIDNSAVARAMLKKTGIQAVLDREDITEVAVNQGSIILFEGKNGWEQIEAPECTYHN
LKALANALSVYSGLKLPFGDTNPIASVVLPDGERGQILTHPATESGTIPLTVRKPSKTRFTVDDYQNSGR
FSKIQIAEAYQKGTIPLYMQDMKKCQKEGNYAEFFRIAAAHNMNTIAVGGTGSGKTTFAKAYADLVPFDH
RIITIEDVHELSLPYHWNHLHLFFDTEYQKSGGISPKELIKSAMRMKPDHIFLTELRGDETWNYFEALNT
GHNGSITSTHANDCRATIPRLTGLVMQSEIGKVLGEQYIQKTLSSALDVICYFKHTYMTEILFEPEKKLE
AMYE
 
Nucleotide Sequence: 1065 bp     [Download]
>gi|71558958|ref|NC_007206.1|:18312-19376 Haemophilus influenzae biotype aegyptius plasmid pF1947, complete sequence
ATGACACATTTTGAAAATGAAGAAATTGAATCCACAGCCGATATTGATAATTCAGCCGTAGCAAGAGCAA
TGTTAAAGAAAACAGGTATTCAAGCCGTTTTAGATCGTGAAGATATTACCGAAGTAGCAGTAAACCAAGG
CAGTATTATCCTGTTTGAAGGTAAAAACGGCTGGGAGCAAATTGAAGCCCCTGAATGTACTTATCACAAC
CTCAAAGCGTTAGCTAACGCTTTGAGTGTGTATAGTGGCTTAAAGCTCCCTTTCGGCGATACAAACCCTA
TTGCGTCCGTTGTTTTACCTGACGGCGAACGGGGGCAAATTTTAACTCACCCAGCAACTGAATCAGGCAC
AATTCCTTTAACGGTGCGTAAGCCGTCTAAAACCCGTTTTACGGTTGATGACTATCAAAATTCAGGACGT
TTTAGCAAAATTCAGATTGCTGAAGCCTATCAAAAAGGCACGATTCCGCTCTATATGCAAGATATGAAAA
AATGCCAAAAAGAGGGCAATTATGCTGAATTTTTTAGAATTGCCGCAGCTCACAATATGAATACGATTGC
CGTAGGCGGCACTGGTTCAGGTAAAACCACGTTTGCAAAAGCCTATGCAGACTTAGTACCGTTCGATCAT
CGCATTATTACAATCGAAGACGTTCACGAATTAAGTCTACCGTATCATTGGAATCATCTACACCTATTTT
TTGATACTGAATATCAAAAATCAGGAGGGATTAGCCCAAAAGAACTTATTAAGTCGGCAATGCGTATGAA
ACCTGATCATATTTTCTTAACAGAATTACGGGGCGATGAAACTTGGAATTATTTTGAGGCATTAAACACA
GGACACAATGGCAGTATTACCTCTACGCACGCTAATGATTGTAGAGCAACAATACCTCGTTTAACAGGGC
TTGTAATGCAATCTGAAATCGGCAAAGTGTTAGGTGAACAATATATTCAAAAAACATTGAGTAGTGCTTT
AGACGTGATTTGTTACTTCAAGCATACCTATATGACTGAAATCTTATTCGAGCCTGAAAAGAAACTCGAA
GCGATGTATGAATAA
 Primer design