SecReT4
Protein ID: 71559040
T4SS name [ID]Tra_F [132]
Gene symboltraX
Locus tagpOU1113_43
StrainSalmonella enterica plasmid pOU1113 (NC_007208)
Repliconplasmid pOU1113 [GenBank: NC_007208] [Browse all T4SS(s) in this replicon]
Location [Strand]27307..28047 [-]
Productconjugal transfer pilus acetylation protein TraX
Component typeTraX_F
UniProt IDQ4L1U1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraX [PF05857], Evalue: 1.2e-47, Aligned region: 30..245
Protein Sequence: 246 a.a.     [Download]
>gi|71559040|ref|YP_271767.1| conjugal transfer pilus acetylation protein TraX [Salmonella enterica]
MTMDNATRNDSRAAQVDTRLQRLLAWSPGQRDLIKTVALLLMVADHINRILHLDLTWLFLAGRGAFPLFA
LVWGLNLSRHTYIRQSAINRLWGWAVIAQSGYFLAGFPWYEGNILFAFAVAAQALKWCELRCLFHSAAAL
LLLTAWIPLSGTSYGVAGVLVLVICYRLYRTADTEEHLALAACLVVAVPALNLVTSDAAAVAGLLVTGLT
VWLVSLTGKSRPRFWPTDFFPVFYTCHLAALGILAL
 
Nucleotide Sequence: 741 bp     [Download]
>gi|71559001|ref|NC_007208.1|:c28047-27307 Salmonella enterica OU7025 plasmid pOU1113, complete sequence
ATGACGATGGATAACGCCACACGTAACGATTCGCGGGCAGCCCAGGTGGATACCCGGCTGCAGCGACTGC
TGGCCTGGTCGCCTGGACAGAGGGATCTCATCAAAACCGTGGCGCTGCTGCTGATGGTGGCTGACCATAT
TAACCGTATCCTGCACCTGGATCTGACGTGGCTGTTTCTGGCCGGGCGCGGGGCGTTTCCGCTGTTTGCC
CTGGTGTGGGGGCTGAACCTGTCCCGGCATACGTATATCCGCCAGTCTGCGATTAACCGGCTGTGGGGAT
GGGCGGTTATCGCACAGTCCGGATATTTTCTGGCGGGATTTCCGTGGTATGAAGGGAATATTCTGTTTGC
CTTTGCGGTGGCCGCGCAGGCGCTGAAGTGGTGTGAGCTGCGCTGCCTGTTTCACTCTGCGGCCGCGCTG
TTACTGCTGACGGCGTGGATACCCCTGTCCGGAACCAGCTACGGCGTTGCCGGCGTGCTGGTGCTGGTCA
TCTGTTACCGGCTGTACCGGACCGCAGATACTGAAGAACATCTGGCGCTTGCGGCCTGCCTGGTGGTGGC
CGTCCCCGCGCTGAATCTGGTCACCAGTGATGCCGCGGCGGTGGCAGGACTTCTGGTGACCGGGCTGACG
GTATGGCTTGTTTCGCTGACAGGCAAATCACGGCCCCGGTTCTGGCCGACTGATTTTTTCCCGGTATTCT
ACACCTGCCATCTGGCTGCCCTGGGCATTCTGGCACTGTAG
 Primer design