SecReT4
Protein ID: 71559041
T4SS name [ID]Tra_F [132]
Gene symboltraI
Locus tagpOU1113_44
StrainSalmonella enterica plasmid pOU1113 (NC_007208)
Repliconplasmid pOU1113 [GenBank: NC_007208] [Browse all T4SS(s) in this replicon]
Location [Strand]28067..33328 [-]
Productconjugal transfer nickase/helicase TraI
Component typeTraI_F
UniProt IDQ4L1U0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrwC [PF08751], Evalue: 4.3e-87, Aligned region: 7..287
TraI [PF07057], Evalue: 2.8e-57, Aligned region: 1430..1556
AAA_30 [PF13604], Evalue: 8.9e-40, Aligned region: 967..1154
UvrD_C_2 [PF13538], Evalue: 4.4e-05, Aligned region: 1337..1440
AAA_19 [PF13245], Evalue: 7.2e-05, Aligned region: 980..1046
Protein Sequence: 1753 a.a.     [Download]
>gi|71559041|ref|YP_271768.1| conjugal transfer nickase/helicase TraI [Salmonella enterica]
MMSIAQVRSAGSAAGYYSDRDNYYVLGSLEERWAGKGAEQLGVQGTVDKEVFTRVLEGRLPDGADLSRQQ
DGGNKHRPGYDLTFSAPKSVSLIAMLAGDKRLTEAHNQAVDIAVRQVEALASTRVMTDGQSETVLTGNLV
MALFNHDTSRDQEPQLHTHAVVANVTLHDGEWKTLSSDKVGKTGFIENVYANQIAFGKIYRAVLKEKVEA
LGYETEVVGKHGMWEMPGVPVEAFSSRSQAIREAVGEDASLKSRDVAALDTRKSKQHVDPEVKMAEWMQT
LKDTGFDISAYREAADRRPEIQAAQPVPSQEQPDIQQAVTQAIAGLSDRKVQFTYTDVLARTVGMLPPEA
GVIEKARAGIDEAISRERLIPLDREKGLFTSGIHVLDELSVRALSSDIMKQNRVTVHPEKSVPRTGSYSD
AVSVLAQDRPSLAIISGQGSAAGQRERVAELTMMAREQGREVQIIAADRRSQTNLKQDERLSGELITGRR
QLQEGMSFSPGSTVIVDQGEKLSLKETLTLLDGAARHNIQVLITDSGQRTGTGSALMAMKEAGVNSYRWQ
GGQQTPATVISEPDRNVRYARLAGDFVAAVKAGEESVAQVSGVREQAILAGMIRSELKTQGVLGQQDTMM
TALSPVWLDSRNRYLRDMYREGMVMEQWNPEKRSHDRYVIDRVTAQSHSLTLRDAQGETQMVRISALDSS
WSLFRPEKIPVADGERLMVTGKIPGLRVSGGDRLQVSAVNDGMMTVIVPGRAEPASLPVGDSPFTALKLE
NGWVETPGHSVSDSAKVFVSVTQMAMDNATLNGLARSGRDVRLYSSLDEPRTAEKLSRHPSFTVVSEQIK
ARAGEVSLETAISRQKAGLHTPAQQPIHLALPVVESKNLAFSQVELLTEAKSFAAEGTGFAELGREIDAQ
IKRGDLLHVDVAKGYGTDLLISRASYDAEKSILHHILEGKEAVTPLMERVSGELMETLTSGQRAATRMIL
ETKDRFTVVQGYAGVGKTTQFRAVMSAVNLLPGSERPRVVGLGPTHRAVGEMRSAGVEAQTLASFLHDTQ
LQQRSGETPDFSNTLFLLDESSMVGNTDMARAYALIAAGGGRAVASGDTDQLQAIAPGQPFRLQQTRSAA
DVAIMKEIVRQTPELRDAVYSLINRDVNKALSGFENVKAGSGSPPEGAWCPENSVTEFSRLQERELVKAA
QEAEKKGEAFPDVLVTLYEAIVRDYTGRTPDAREQTLIVTHLNEDRRVLNSMIQDALAKPGEQQVTVPVL
TTANIRDGELRRLSTWENHQCALALVDKVYHRIAGISKEDGLITLQDADGNTRLISPREAAAEGVTLYNP
ETIRVGAGDRMRFTKSDRERGYVANSVWPVTAVSGDGVTLSDGKQTRVVRPGQDRAEQHIDLAYAITAHG
AQGASETFAIALEGTEGGRKQMAGFESAYVALSRMKQHVQVYTDDRQGWTDAINRAAQKGTAHDVLEPKA
DREAMNAERLFSTARELRDVAAGRAVLRNAGLALGDSRARFIAPGRKYPQPYVALPAFDRNGKSAGIWLN
PLTTDDGAGLRGFSGEGRVKGSEEAQFVALQGSRNGESLLADNMQEGVRIARDNPDSGVVVRIAGDGRPW
NPGAITGGRVWGDIPDSSVQPGAVNGEPVTAEILAQRQAEEAVRRETEQRAAEIVRKMAEDKPDLPEEKT
AQAVREIAGQEHDRMTPPERETPLPESVLREPVRERETIPGSGAGKPGSGAAAADGAGDGASTCRKREPP
DGD
 
Nucleotide Sequence: 5262 bp     [Download]
>gi|71559001|ref|NC_007208.1|:c33328-28067 Salmonella enterica OU7025 plasmid pOU1113, complete sequence
ATGATGAGCATTGCACAGGTCCGGTCAGCGGGGAGTGCCGCCGGTTATTACAGCGACAGGGATAACTACT
ACGTGCTGGGCAGTCTGGAGGAACGCTGGGCCGGAAAAGGCGCGGAGCAACTGGGGGTGCAGGGCACCGT
CGATAAGGAGGTGTTCACCCGGGTACTGGAAGGCCGACTGCCCGACGGGGCTGATCTGAGCCGACAGCAG
GACGGCGGCAACAAACACCGCCCCGGCTATGATCTGACCTTCTCTGCCCCCAAAAGTGTTTCCCTGATAG
CCATGCTGGCCGGCGATAAACGCCTGACTGAGGCACACAACCAGGCGGTGGATATCGCTGTCCGTCAGGT
TGAGGCGCTGGCCTCCACCAGAGTGATGACGGACGGGCAGTCAGAAACCGTGCTCACCGGGAACCTGGTG
ATGGCGCTGTTCAATCATGACACCAGTCGTGACCAGGAGCCGCAGCTGCATACCCATGCCGTGGTGGCCA
ACGTCACGCTGCATGACGGGGAATGGAAGACCCTGAGCAGTGATAAGGTGGGAAAAACGGGATTTATCGA
GAATGTCTATGCTAACCAGATAGCCTTCGGGAAGATTTACCGCGCGGTGCTGAAAGAGAAGGTTGAAGCG
CTGGGCTATGAAACGGAAGTGGTCGGTAAGCACGGTATGTGGGAGATGCCCGGTGTCCCGGTGGAGGCCT
TTTCCAGCCGTTCGCAGGCCATCCGGGAGGCGGTCGGGGAGGATGCCTCGCTGAAATCCCGGGATGTGGC
GGCGCTGGATACGCGTAAATCCAAACAGCATGTCGATCCGGAAGTGAAAATGGCTGAGTGGATGCAGACC
CTGAAAGATACCGGGTTTGATATCAGCGCATACCGTGAGGCTGCGGACAGGCGGCCGGAAATACAGGCAG
CACAGCCTGTTCCGTCACAGGAGCAGCCGGATATTCAGCAGGCGGTGACGCAGGCCATTGCCGGATTAAG
CGACCGGAAGGTTCAGTTTACGTATACCGACGTGCTGGCCAGAACGGTTGGCATGCTGCCGCCGGAAGCC
GGCGTGATTGAGAAAGCCCGGGCCGGGATTGATGAGGCCATCAGCCGCGAGCGGCTTATCCCCCTCGACC
GGGAGAAAGGACTGTTCACCTCCGGTATTCATGTGCTCGATGAGCTGTCTGTCCGGGCACTCAGCAGCGA
TATCATGAAGCAGAACCGGGTGACCGTCCATCCGGAGAAGAGCGTGCCCCGCACGGGAAGTTACAGCGAC
GCGGTGAGTGTCTTGGCTCAGGATCGCCCGTCACTGGCCATTATCAGTGGTCAGGGCAGTGCTGCCGGTC
AGCGGGAGCGGGTGGCGGAGCTGACGATGATGGCCCGGGAGCAGGGGCGTGAGGTGCAGATTATTGCCGC
CGACCGCCGTTCGCAGACGAACCTGAAGCAGGATGAACGTCTGTCCGGTGAGCTGATAACCGGGCGTCGT
CAGTTGCAGGAGGGCATGTCATTTTCCCCGGGCAGTACCGTTATTGTCGACCAGGGCGAAAAGCTGTCCC
TGAAGGAGACTCTGACCCTGCTGGATGGCGCGGCGCGTCATAACATCCAGGTGCTCATTACCGACAGCGG
TCAGCGCACCGGTACCGGCAGCGCGCTGATGGCCATGAAGGAGGCCGGCGTGAACAGTTACCGCTGGCAG
GGCGGGCAGCAGACCCCGGCGACCGTTATCAGCGAGCCGGACCGGAATGTCCGCTATGCCCGGCTGGCCG
GGGATTTTGTGGCCGCGGTGAAAGCCGGGGAAGAGAGCGTGGCGCAGGTCAGCGGCGTGCGTGAGCAGGC
CATACTGGCGGGGATGATACGCAGTGAGCTGAAGACGCAGGGGGTACTCGGGCAGCAGGACACCATGATG
ACCGCGCTGTCACCGGTCTGGCTGGACAGCCGGAACCGTTACCTGCGCGACATGTACCGTGAAGGGATGG
TGATGGAGCAGTGGAACCCGGAGAAACGGTCCCATGACCGGTATGTGATTGACCGGGTGACCGCACAAAG
TCACAGTCTGACCCTGCGGGATGCGCAGGGAGAGACGCAGATGGTGCGGATTTCAGCCCTGGACAGCAGC
TGGTCACTCTTCCGGCCGGAGAAGATACCGGTGGCAGACGGCGAGCGTCTTATGGTGACGGGAAAAATTC
CCGGGCTTCGCGTCTCCGGCGGCGACCGGCTGCAGGTATCAGCGGTGAACGATGGCATGATGACGGTCAT
CGTTCCGGGACGGGCTGAGCCGGCTTCCCTGCCTGTGGGGGATTCCCCGTTCACGGCGCTGAAGCTGGAA
AACGGCTGGGTGGAAACACCCGGGCATTCCGTCAGTGACAGTGCGAAAGTTTTTGTTTCCGTCACACAGA
TGGCGATGGACAACGCCACCCTGAACGGTCTGGCCCGCAGCGGCCGGGATGTCCGGCTGTATTCCTCACT
GGATGAGCCCCGCACTGCTGAAAAACTCTCCCGTCACCCGTCTTTTACGGTCGTTTCTGAGCAGATAAAG
GCGCGTGCCGGTGAGGTATCGCTGGAAACCGCCATCAGCCGCCAGAAAGCCGGGCTTCACACGCCGGCAC
AGCAGCCCATTCACCTTGCCCTTCCGGTGGTGGAAAGTAAAAACCTGGCATTCAGTCAGGTGGAGCTGCT
GACGGAGGCGAAGTCGTTTGCTGCAGAGGGAACCGGTTTTGCTGAACTGGGACGGGAAATTGATGCGCAG
ATAAAACGGGGCGATTTACTGCATGTGGATGTGGCAAAAGGTTATGGTACAGACCTGCTGATTTCCCGTG
CATCGTATGACGCTGAAAAGAGTATTCTGCATCATATCCTTGAGGGAAAGGAGGCGGTCACGCCACTGAT
GGAGAGGGTATCCGGCGAACTCATGGAGACTCTGACATCCGGACAGCGTGCCGCCACCCGTATGATACTC
GAAACGAAAGACCGTTTCACCGTGGTACAGGGCTACGCCGGGGTGGGCAAGACCACCCAGTTCCGGGCGG
TGATGTCTGCCGTGAACCTACTGCCTGGGAGTGAGCGTCCCCGCGTCGTGGGGCTGGGGCCGACCCACAG
GGCGGTCGGGGAGATGCGCAGTGCCGGCGTGGAAGCACAGACGCTGGCGTCCTTTCTGCATGACACGCAG
CTGCAGCAGCGCAGCGGTGAAACACCGGATTTCAGCAACACGCTGTTCCTCCTTGATGAGAGTTCGATGG
TGGGCAACACCGATATGGCGCGGGCATACGCCCTGATTGCGGCCGGTGGTGGTCGTGCCGTGGCTAGTGG
TGACACGGACCAACTGCAGGCCATCGCACCCGGTCAGCCTTTCCGTCTGCAGCAGACACGCAGTGCCGCC
GATGTGGCCATCATGAAAGAGATTGTGCGCCAGACACCGGAACTGCGGGACGCCGTGTACAGCCTGATTA
ACCGGGATGTGAATAAGGCACTGTCCGGCTTTGAAAACGTGAAAGCCGGTTCAGGTTCCCCGCCTGAAGG
GGCATGGTGCCCGGAAAACTCGGTGACGGAGTTCAGCCGTCTGCAGGAGCGGGAACTGGTGAAAGCCGCA
CAGGAGGCGGAGAAAAAGGGCGAAGCCTTTCCGGATGTGCTCGTGACGCTGTATGAGGCCATTGTCCGCG
ACTATACCGGCAGAACGCCGGACGCCCGGGAGCAGACGCTGATTGTCACGCATCTGAATGAGGATCGTCG
GGTGCTGAACAGCATGATTCAGGATGCACTGGCGAAACCGGGTGAGCAGCAGGTCACTGTCCCTGTACTG
ACCACCGCGAATATCCGTGACGGGGAGCTGCGCCGTCTGTCCACCTGGGAGAATCATCAGTGCGCGCTTG
CCCTGGTGGATAAAGTGTATCACCGGATTGCCGGTATCAGTAAGGAGGACGGGCTGATAACCCTGCAGGA
TGCCGACGGCAACACGCGCCTGATTTCCCCTCGGGAAGCAGCGGCAGAGGGCGTCACACTGTACAATCCG
GAAACTATCCGGGTGGGGGCCGGTGACCGGATGCGTTTCACGAAGAGTGACAGGGAACGCGGGTATGTGG
CCAACAGCGTCTGGCCGGTGACCGCGGTTTCCGGTGACGGTGTCACGCTGTCAGACGGGAAACAGACCCG
CGTGGTGCGTCCCGGGCAGGACAGGGCAGAGCAGCATATTGACCTGGCGTATGCCATCACCGCCCACGGT
GCGCAGGGGGCCAGTGAGACGTTTGCCATTGCGCTGGAGGGAACCGAAGGGGGCCGGAAACAGATGGCCG
GTTTTGAGTCGGCGTATGTGGCCCTGTCGCGTATGAAACAGCATGTGCAGGTGTACACCGACGATCGTCA
GGGCTGGACTGATGCCATCAACAGAGCCGCACAGAAAGGTACTGCCCACGATGTGCTGGAGCCGAAAGCA
GACCGGGAGGCCATGAATGCAGAGCGGCTGTTCAGCACCGCCCGGGAACTGCGGGACGTGGCCGCCGGCC
GTGCCGTGCTGCGAAACGCCGGACTGGCGCTGGGAGACAGCCGGGCGCGTTTTATTGCACCGGGGCGCAA
ATATCCGCAGCCGTATGTGGCGCTGCCGGCGTTTGACCGTAACGGTAAATCCGCCGGTATCTGGCTGAAC
CCACTGACAACGGATGACGGTGCCGGGCTGCGGGGCTTCAGCGGTGAAGGACGGGTGAAAGGCAGCGAAG
AGGCGCAGTTTGTGGCCCTGCAGGGCAGTCGTAACGGCGAAAGCCTGCTGGCTGATAACATGCAGGAGGG
CGTCCGGATTGCCCGCGATAACCCTGACAGCGGCGTGGTGGTGAGAATTGCCGGTGACGGGCGTCCGTGG
AATCCCGGCGCCATTACCGGCGGCAGGGTGTGGGGCGATATTCCTGACAGCAGTGTGCAACCCGGCGCGG
TCAACGGGGAGCCGGTCACGGCAGAGATTCTGGCACAGCGGCAGGCAGAAGAGGCAGTCCGCCGTGAAAC
AGAGCAGCGTGCCGCAGAGATTGTCCGTAAAATGGCTGAGGATAAACCTGACCTGCCGGAGGAGAAAACC
GCGCAGGCGGTCAGAGAGATTGCCGGCCAGGAGCATGACAGAATGACCCCGCCTGAACGGGAAACCCCGC
TGCCGGAGAGTGTGCTGCGCGAACCGGTACGGGAGCGGGAGACCATTCCGGGAAGTGGCGCCGGAAAACC
GGGTTCGGGAGCCGCTGCAGCAGACGGAGCAGGAGATGGTGCGTCGACCTGCAGAAAGAGAGAACCCCCG
GACGGGGACTGA
 Primer design