SecReT4
Protein ID: 71559042
T4SS name [ID]Tra_F [132]
Gene symbol-
Locus tagpOU1113_45
StrainSalmonella enterica plasmid pOU1113 (NC_007208)
Repliconplasmid pOU1113 [GenBank: NC_007208] [Browse all T4SS(s) in this replicon]
Location [Strand]33423..35441 [-]
Productconjugative transfer DNA transport protein
Component typeTraD_F
UniProt IDQ4L1T9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 1.8e-143, Aligned region: 171..560
TraD_N [PF12615], Evalue: 3.7e-25, Aligned region: 30..128
TraG-D_C [PF12696], Evalue: 1e-18, Aligned region: 418..540
T4SS-DNA_transf [PF02534], Evalue: 5.7e-10, Aligned region: 393..505
AAA_10 [PF12846], Evalue: 4.5e-07, Aligned region: 397..490
Protein Sequence: 672 a.a.     [Download]
>gi|71559042|ref|YP_271769.1| conjugative transfer DNA transport protein [Salmonella enterica]
MSFNAKDMTQGGQIASMRIRMFSQIATLYFTACYFFWILVGLGVWGENSAADVVNGVYLTVVYHAGRNAE
LNLIQPVYEIRYYGQTFRMNAVKVLQDKYTVWCGEQLWSAFVLAACVALVICLITFFMTTWILGRQGKQQ
SEDDVTGGRQLTDNPKDVARILKKDGKASDILIGDLPIIKDSEIQNFLLHGTVSTGKSEIIRRLANYARQ
RGDMVVMYDRSCEFVKSYYDPSIDKILNPCDARCAAWDLWRECLTLPDFDNAANTLIPMGTKEDPFWQGS
GRTIFAEAAYLMRNDSDRSYSKLVDTLLSIKIEKLRTYLRDSPAANLVEEKIEKTAISIRAVLTNYVKAV
RYLQGIERNGEPFTIRDWMRGVREDQKNGWLFISSNADTHSSLKPVISMWLSIAIRGLLAMGENRNRRVW
FFCDELPTLHKLPDLVEIVPEARKFGGCYVFGIQSSTQMEDIYGEKAAATLLDVMNTRAFFRSPSYKIAD
YVAHEIGEKEILKASEQYSYGADPVRDGVSTGKEMERVTLVSYSDIQSLPDLTCYVTLPGPYPAVKLALK
YQERPKVAPEFIPREMNPEAEARLSAVLAAREAEGRQMSSLFEPDTEAVAPAAAEAQAEQPQQPQQPQQP
QQPQQPQQPQQPQQPQPTVVSDKKSAAAGTAANTSAGGRSRR
 
Nucleotide Sequence: 2019 bp     [Download]
>gi|71559001|ref|NC_007208.1|:c35441-33423 Salmonella enterica OU7025 plasmid pOU1113, complete sequence
ATGAGCTTTAATGCGAAGGATATGACCCAGGGCGGTCAGATTGCGTCCATGCGTATTCGCATGTTCAGCC
AGATCGCAACATTATATTTTACTGCCTGTTATTTCTTCTGGATACTCGTCGGCCTGGGTGTATGGGGTGA
AAACTCAGCTGCAGACGTTGTGAATGGGGTGTATCTAACTGTGGTGTACCACGCTGGAAGGAATGCGGAA
TTAAATTTAATCCAGCCTGTCTATGAGATCCGGTATTACGGCCAGACGTTCCGGATGAACGCCGTCAAGG
TTCTGCAGGACAAATACACGGTCTGGTGTGGGGAGCAACTGTGGTCGGCCTTTGTTCTGGCCGCCTGTGT
GGCGCTGGTTATCTGCCTGATTACATTTTTTATGACCACATGGATTCTGGGACGTCAGGGAAAACAGCAG
AGTGAGGATGATGTTACCGGAGGACGCCAACTTACCGACAATCCGAAAGACGTTGCCAGAATACTGAAAA
AAGACGGAAAAGCGTCCGATATCCTGATTGGCGATTTGCCAATCATTAAGGATTCAGAGATTCAGAACTT
TTTGCTCCACGGGACAGTCAGTACCGGTAAGTCTGAAATCATTCGCCGGCTGGCTAACTATGCCCGTCAG
CGCGGCGACATGGTGGTGATGTACGATCGTTCCTGTGAGTTTGTCAAAAGCTACTACGACCCGTCCATCG
ATAAAATTCTCAACCCCTGTGACGCGCGGTGTGCCGCATGGGATTTATGGCGGGAATGCCTCACCCTGCC
GGATTTTGATAATGCGGCGAATACCCTGATCCCGATGGGCACGAAGGAAGATCCGTTCTGGCAGGGTTCC
GGACGAACCATTTTTGCTGAAGCGGCATACCTGATGCGTAATGACAGCGATCGCAGCTACAGTAAGCTGG
TTGACACGCTGCTCTCAATCAAAATTGAAAAACTGCGAACCTACCTGCGTGATTCCCCGGCGGCCAACCT
GGTGGAAGAAAAAATCGAGAAGACGGCCATTTCCATCCGGGCCGTGCTGACCAACTATGTAAAAGCCGTC
CGCTATCTTCAGGGGATCGAGCGTAACGGTGAACCGTTCACCATCCGTGACTGGATGCGCGGCGTCCGGG
AGGATCAAAAAAACGGCTGGCTGTTTATTTCTTCAAACGCTGACACACATTCTTCCCTGAAGCCGGTGAT
TTCCATGTGGCTGTCCATTGCCATCCGGGGCCTGCTGGCGATGGGAGAGAACCGTAACCGTCGGGTGTGG
TTCTTCTGTGATGAGTTGCCCACGCTGCACAAGCTGCCCGACCTCGTGGAAATTGTCCCGGAAGCCCGTA
AATTCGGGGGCTGCTATGTCTTTGGTATTCAGTCCAGTACACAGATGGAGGATATCTATGGCGAGAAAGC
GGCGGCAACCCTGCTGGATGTTATGAACACAAGGGCCTTTTTCCGCTCACCCAGCTATAAGATTGCCGAC
TATGTCGCCCATGAGATTGGTGAAAAAGAGATCCTGAAAGCCAGTGAGCAGTATTCCTATGGTGCCGATC
CCGTTCGTGACGGGGTGTCAACCGGTAAGGAGATGGAGCGTGTCACACTGGTCAGCTACTCCGATATTCA
GTCACTGCCCGACCTTACCTGTTATGTCACGCTGCCCGGACCCTATCCGGCAGTGAAGCTGGCCCTGAAA
TACCAGGAACGTCCCAAAGTGGCGCCGGAGTTTATTCCCCGGGAAATGAATCCTGAGGCGGAAGCCCGTC
TGAGCGCCGTTCTGGCTGCAAGGGAAGCTGAGGGACGTCAGATGTCCAGCCTGTTTGAACCGGATACAGA
AGCGGTTGCGCCGGCAGCAGCAGAAGCGCAGGCTGAACAGCCGCAACAGCCGCAACAGCCGCAACAGCCG
CAACAGCCGCAACAGCCGCAACAGCCGCAACAGCCGCAACAGCCACAGCCCACGGTTGTCAGCGATAAAA
AATCAGCAGCGGCGGGTACCGCCGCGAATACGTCCGCAGGCGGCAGGAGCAGGAGGTGA
 Primer design