SecReT4
Protein ID: 71559044
T4SS name [ID]Tra_F [132]
Gene symboltraG
Locus tagpOU1113_47
StrainSalmonella enterica plasmid pOU1113 (NC_007208)
Repliconplasmid pOU1113 [GenBank: NC_007208] [Browse all T4SS(s) in this replicon]
Location [Strand]37297..40119 [-]
Productconjugal transfer mating pair stabilization protein TraG
Component typeTraG_F
UniProt IDQ4L1T7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 1.1e-124, Aligned region: 3..450
Protein Sequence: 940 a.a.     [Download]
>gi|71559044|ref|YP_271771.1| conjugal transfer mating pair stabilization protein TraG [Salmonella enterica]
MNEVYVIAGGEWLSNNLNAIAAFMSSRTWDSIEKIALTLAVLAVAVMWVQRHNVMDLLGWVAVFVLISLL
VTIRTSVQIIDNSDLVRVYRVDNVPVGLALPLSLTTRIGHAMVASYEMIFAQPDSVTYSKTGMLFGAGLV
TKSTDFLSRNPEITGLFQDYVQNCVMGDIYLNHKYSLEELMESGDPYTLIFSNPSPLRGVFDKNNHFLTC
KDASVTLKDKLNLDTKTGGRTWHYYVQQLFGGRPDPNLLFSTMLGDSYSYFYGSSQSASQIIRQNVTINA
LRDGITSYAARSGDPGSLMNLGTTSSMEKQRLAHASIGQVAMRTLPMTQTILLGIAIGIFPLLVLVAVFN
KLTLSVLKGYVFALMWLQSWPLLYAILNSAMTFYARQNGVPVVLSEMSQIQLKYSDLATTAGYISMMIPP
LSWAMVKGLGAGFSGVYSHFASSAISPTASAAAGVVDGNYSYGNMQTENVNGFSWSTNSTTSFGQMTYQT
GSGATATQTRDGNMVMDASGAQSRLPVNINATRQIAAAQQEMAREASTQAESALHGFSSSIASAWNTLSQ
FGTNRGSSDSVTSGADSTMSAQDSMMASRMRSAVESYAKAHNISNEQDTQELASRSTRTSAGIYGDAHAE
WGIRPKILGVRGGAGVKGGGKAGIDWEDNDSHQASSNTHASHNTRHDVDAKATQDFKEASDYFTSRKVSE
SGSHTDNNAESRVDHLSAALNSAKQSYDQYTTNLSRSHEYAEMASRTESMSGQMSEDLSQQFVNYVQKHA
PNDAEAILTNTSSPEVAEQRRAMAWSFVQEQVQPGVDNAWSEGRSETGRGMGVVSGGGDRQDVIADHQAH
QATLDQRTQDSNIRNDVKPQVDNMVTAYRSGISDTQENIQGEEKAIGQQYSDLQKQHKTEALSQDNKYNE
ETSAQKRMPGADSPEELMKRAKEYQDKHKP
 
Nucleotide Sequence: 2823 bp     [Download]
>gi|71559001|ref|NC_007208.1|:c40119-37297 Salmonella enterica OU7025 plasmid pOU1113, complete sequence
GTGAACGAGGTTTATGTCATTGCCGGCGGAGAATGGCTGAGTAATAACCTGAACGCCATTGCGGCCTTCA
TGAGCAGCCGGACGTGGGACTCCATTGAGAAAATTGCGCTGACCCTGGCCGTTCTCGCGGTGGCCGTTAT
GTGGGTACAGCGACATAACGTGATGGATCTGCTGGGCTGGGTGGCGGTGTTTGTGCTGATATCACTTCTG
GTGACCATACGGACATCGGTACAGATAATTGATAACAGCGACCTGGTGAGGGTTTACCGGGTGGATAATG
TGCCGGTCGGACTGGCCCTTCCCCTTTCGCTGACAACCCGGATCGGGCATGCGATGGTGGCCAGCTATGA
GATGATTTTTGCCCAGCCTGACAGCGTCACCTACAGCAAGACAGGTATGCTGTTCGGGGCGGGACTGGTG
ACGAAAAGTACCGACTTTCTGTCACGCAATCCGGAAATTACCGGCCTTTTCCAGGACTATGTTCAGAACT
GTGTGATGGGCGATATTTACCTCAATCACAAATATTCCCTGGAAGAACTGATGGAGTCCGGCGATCCCTA
TACGCTGATTTTTTCAAATCCCAGTCCATTACGGGGTGTCTTTGACAAAAATAATCATTTTCTCACCTGT
AAGGATGCGTCCGTAACGCTGAAAGACAAGCTGAATCTTGATACAAAGACAGGAGGCAGGACCTGGCATT
ATTATGTACAACAGTTATTTGGTGGACGTCCGGACCCGAACCTGCTGTTCAGTACGATGCTCGGGGACAG
TTACAGCTATTTCTACGGCTCCAGCCAGTCAGCCAGCCAGATTATCCGCCAGAACGTCACGATTAACGCC
TTAAGGGATGGAATAACCAGTTATGCCGCCCGGAGTGGTGATCCGGGCAGCCTGATGAACCTGGGCACCA
CATCTTCAATGGAAAAACAGCGTCTGGCGCATGCCAGCATCGGGCAGGTGGCGATGCGTACCCTGCCAAT
GACACAGACCATTCTGCTGGGGATAGCCATTGGGATTTTCCCGTTACTGGTTCTGGTCGCTGTCTTTAAT
AAACTGACGCTGTCAGTGCTGAAAGGGTATGTGTTTGCCCTGATGTGGCTGCAGAGCTGGCCGTTGCTGT
ATGCCATTCTGAACAGCGCCATGACCTTTTATGCCAGGCAGAACGGTGTACCGGTGGTATTGTCTGAAAT
GTCACAGATACAGCTGAAATACTCCGATCTGGCCACGACGGCAGGGTATATCTCGATGATGATCCCGCCG
CTGTCGTGGGCGATGGTGAAAGGGCTCGGGGCGGGCTTCTCCGGGGTGTACAGCCATTTTGCCTCTTCGG
CGATCAGCCCGACAGCCAGTGCGGCCGCCGGCGTGGTGGACGGCAATTATTCCTACGGCAATATGCAGAC
GGAGAACGTCAACGGCTTCAGCTGGAGTACCAACAGTACCACGTCATTTGGCCAGATGACTTACCAGACC
GGCAGTGGAGCAACCGCCACGCAGACCCGGGACGGCAATATGGTCATGGATGCCAGCGGCGCGCAGTCCA
GACTGCCGGTGAATATCAACGCGACCCGGCAGATAGCGGCGGCACAGCAGGAGATGGCGCGGGAAGCCAG
CACGCAGGCAGAAAGCGCCCTGCATGGTTTCAGCAGCAGTATCGCCAGCGCCTGGAATACGCTCAGTCAG
TTCGGGACGAACCGGGGCAGCAGCGACTCAGTGACCAGTGGTGCTGACAGCACCATGAGCGCGCAGGATT
CCATGATGGCCAGCCGGATGCGCAGCGCAGTGGAAAGTTATGCGAAGGCACATAATATCAGCAATGAGCA
GGACACCCAGGAGTTGGCTTCGAGAAGCACCAGAACATCGGCGGGTATTTATGGCGATGCACATGCAGAG
TGGGGCATAAGGCCCAAGATATTGGGGGTCCGTGGTGGGGCTGGTGTTAAAGGTGGTGGCAAGGCTGGCA
TAGACTGGGAAGATAATGACTCACATCAGGCCAGCAGTAATACCCATGCCAGCCATAATACACGTCATGA
TGTGGATGCCAAAGCCACACAGGATTTTAAAGAGGCCAGCGATTACTTTACGAGCCGTAAGGTCAGTGAA
TCCGGGAGCCATACGGACAATAATGCAGAATCCCGGGTGGATCATCTGTCTGCGGCACTGAATTCTGCTA
AGCAAAGTTATGACCAGTACACCACGAATCTCTCCCGCAGCCATGAGTATGCTGAGATGGCATCCCGTAC
AGAAAGCATGAGCGGACAGATGAGTGAGGATTTGTCACAGCAGTTTGTGAATTATGTACAGAAGCATGCG
CCGAATGATGCTGAAGCCATTCTGACAAATACCAGCTCTCCGGAAGTGGCGGAACAACGCCGGGCAATGG
CCTGGTCTTTTGTTCAGGAACAGGTTCAGCCCGGGGTGGATAATGCCTGGAGTGAAGGTCGTAGTGAGAC
AGGCAGAGGGATGGGCGTGGTATCCGGTGGTGGTGACCGACAGGATGTTATTGCCGATCACCAGGCTCAT
CAGGCGACACTCGACCAGCGGACACAGGACAGTAATATTCGCAATGATGTGAAGCCTCAGGTTGATAATA
TGGTCACAGCATACCGTTCCGGTATCAGCGATACTCAGGAAAACATCCAGGGTGAGGAAAAGGCTATCGG
CCAGCAGTATTCTGACCTACAGAAACAGCATAAAACAGAAGCACTCTCTCAGGATAATAAATATAATGAA
GAGACATCTGCCCAGAAACGGATGCCCGGTGCTGACAGTCCGGAAGAACTTATGAAAAGGGCGAAGGAGT
ATCAGGACAAGCATAAACCTTAG
 Primer design