SecReT4
Protein ID: 71559045
T4SS name [ID]Tra_F [132]
Gene symboltraH
Locus tagpOU1113_48
StrainSalmonella enterica plasmid pOU1113 (NC_007208)
Repliconplasmid pOU1113 [GenBank: NC_007208] [Browse all T4SS(s) in this replicon]
Location [Strand]40116..41498 [-]
Productconjugal transfer pilus assembly protein TraH
Component typeTraH_F
UniProt IDQ4L1T6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 3e-119, Aligned region: 32..381
Protein Sequence: 460 a.a.     [Download]
>gi|71559045|ref|YP_271772.1| conjugal transfer pilus assembly protein TraH [Salmonella enterica]
MQGKTRIKPLFILCTALMTVAPAVSADVNSDMNQFFNKLGFASNTTQPSVWQGQAAGYASGGSLYARTQV
KNVQLVSMTLPDINAGCGGIDAYLGSFSFINGEQLQRFVKQIMSNAAGYFFDLALQTTVPEIKTAKDFLQ
KMASDINSMNLSSCQAAQGIVGGLFPKTQVSQQKVCQDIAGESNIFADWAASRQGCTVGGQSDSVRDKAS
DRDKERVTKNINIMWNALSKNRMFDGNKELKEFVMTLTGSLVFGPNGEITPLPARTTDRAIIRALMEGGT
AKIYHCNDSDKCLKVVADTPVTISRDNALKSQITKLLTSIQNKAVSDTPLDNKEKGFISSTTIPVFKYLV
DPQMLGVSTSMIYQLTDYIGYDILLQYIQELIQQARAMVATGNYDEAVIEHITDNMNDATRQIASFQAQV
QVQQDALLVVDRQMSYMRQQLSARMLSRYQNNYHFGGGAQ
 
Nucleotide Sequence: 1383 bp     [Download]
>gi|71559001|ref|NC_007208.1|:c41498-40116 Salmonella enterica OU7025 plasmid pOU1113, complete sequence
ATGCAGGGTAAAACGAGAATTAAACCGCTTTTCATATTATGTACGGCGCTGATGACCGTCGCACCCGCCG
TCTCTGCCGATGTGAACAGCGACATGAACCAGTTCTTCAATAAGCTGGGCTTTGCTTCCAATACCACACA
GCCCTCCGTCTGGCAGGGACAGGCGGCAGGATATGCCTCCGGCGGCTCTTTATATGCCCGGACACAGGTA
AAAAATGTCCAGCTGGTCTCCATGACCCTGCCGGATATCAATGCCGGTTGCGGGGGCATCGATGCCTATC
TCGGCTCATTCAGTTTCATTAACGGCGAGCAACTGCAGCGTTTTGTGAAGCAGATTATGAGTAACGCCGC
AGGGTACTTTTTTGACCTTGCGCTGCAGACGACGGTGCCGGAAATCAAAACGGCAAAGGATTTTCTGCAG
AAAATGGCCAGCGATATTAACAGTATGAACCTCAGTTCCTGCCAGGCGGCGCAGGGGATTGTCGGGGGGC
TTTTCCCAAAAACACAGGTCTCCCAGCAGAAGGTCTGCCAGGACATTGCCGGTGAGAGCAATATTTTTGC
CGACTGGGCGGCGTCCCGGCAGGGATGTACTGTGGGCGGGCAATCCGACAGCGTCAGGGATAAAGCCAGT
GACAGGGATAAGGAGCGGGTGACCAAAAATATCAACATCATGTGGAATGCTTTGTCCAAAAACAGGATGT
TTGACGGCAACAAGGAGTTGAAAGAGTTCGTGATGACGCTGACCGGTTCACTGGTTTTTGGACCCAACGG
CGAAATCACGCCCCTGCCTGCCAGAACCACCGACCGGGCTATTATCCGGGCATTAATGGAAGGCGGAACG
GCGAAGATATACCACTGCAATGATTCGGATAAATGCCTGAAGGTGGTGGCCGACACGCCGGTGACCATCA
GTCGCGACAATGCGCTCAAATCACAGATTACGAAGCTGCTGACCAGTATTCAGAACAAGGCGGTCAGCGA
CACTCCCCTGGATAATAAGGAAAAAGGGTTTATCTCTAGCACCACCATCCCGGTTTTCAAATACCTGGTT
GACCCGCAGATGCTCGGTGTGTCAACCAGCATGATTTATCAGCTGACGGATTATATCGGGTACGACATCC
TGCTGCAGTATATCCAGGAGCTGATCCAGCAGGCCAGGGCGATGGTGGCCACAGGAAATTATGACGAGGC
GGTTATCGAACATATCACCGACAACATGAATGACGCGACCCGGCAGATAGCGTCCTTCCAGGCGCAGGTC
CAGGTGCAGCAGGATGCGCTGCTGGTTGTCGACCGTCAGATGAGCTACATGCGCCAGCAGCTGTCAGCCC
GCATGCTCAGCCGTTACCAGAACAACTATCATTTTGGCGGAGGTGCGCAGTGA
 Primer design