SecReT4
Protein ID: 71559047
T4SS name [ID]Tra_F [132]
Gene symboltraQ
Locus tagpOU1113_50
StrainSalmonella enterica plasmid pOU1113 (NC_007208)
Repliconplasmid pOU1113 [GenBank: NC_007208] [Browse all T4SS(s) in this replicon]
Location [Strand]42023..42316 [-]
Productconjugal transfer pilin chaperone TraQ
Component typeTraQ_F
UniProt IDQ4L1T4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraQ [PF09679], Evalue: 2.1e-46, Aligned region: 1..97
Protein Sequence: 97 a.a.     [Download]
>gi|71559047|ref|YP_271774.1| conjugal transfer pilin chaperone TraQ [Salmonella enterica]
MRKYKLSLPLPDITGSMGFLPGRLVHIVGRLVYRKPWMAFFLAELIAVILVLSGAYRVLDAWIARVSREE
RALLEARQTAILAAEKEEKGDKSHVSQ
 
Nucleotide Sequence: 294 bp     [Download]
>gi|71559001|ref|NC_007208.1|:c42316-42023 Salmonella enterica OU7025 plasmid pOU1113, complete sequence
GTGCGTAAATATAAATTATCGCTTCCTTTACCGGATATTACCGGGAGTATGGGTTTTCTTCCTGGGCGTC
TGGTTCACATTGTCGGGCGGCTGGTTTACCGCAAACCCTGGATGGCTTTTTTTCTGGCGGAACTGATTGC
CGTCATTCTGGTGTTGTCCGGCGCTTACCGGGTGCTGGATGCCTGGATAGCCCGCGTCAGCCGGGAAGAG
CGTGCGTTACTGGAAGCCCGTCAGACAGCCATTCTGGCTGCTGAAAAAGAAGAAAAGGGGGATAAATCAC
ATGTCTCTCAATAA
 Primer design