SecReT4
Protein ID: 71559048
T4SS name [ID]Tra_F [132]
Gene symboltraF
Locus tagpOU1113_51
StrainSalmonella enterica plasmid pOU1113 (NC_007208)
Repliconplasmid pOU1113 [GenBank: NC_007208] [Browse all T4SS(s) in this replicon]
Location [Strand]42530..43273 [-]
Productconjugal pilus assembly protein TraF
Component typeTraF_F
UniProt IDQ4L1T3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 3.4e-74, Aligned region: 25..236
Protein Sequence: 247 a.a.     [Download]
>gi|71559048|ref|YP_271775.1| conjugal pilus assembly protein TraF [Salmonella enterica]
MRKKQIVWLAALLCGPLVAYGKDAGWQWYNEKVSPQETENKPAVPRQEPDIMQKLATLQAATKRALYEAI
LYPGVDNFVKYFRLQNYWTQQAGLFSMSAKKAMLAHPELDYNLQYSHYNGTVRNQLAADQAQQRQAISKL
AEHYGIMFFYRGQDPIDGQLAQVINGFRATYGLSVIPVTVDGVINPMLPDTRPDQGQAQRLGVKYFPAMM
LVDPKQGSVRPLSYGFITQDDLAKQFQNVSEDFKPNF
 
Nucleotide Sequence: 744 bp     [Download]
>gi|71559001|ref|NC_007208.1|:c43273-42530 Salmonella enterica OU7025 plasmid pOU1113, complete sequence
ATGCGAAAAAAACAGATCGTGTGGCTGGCGGCGTTACTCTGTGGTCCCCTGGTGGCATACGGAAAAGATG
CTGGCTGGCAGTGGTATAACGAAAAAGTCAGTCCGCAGGAGACGGAAAATAAACCTGCTGTGCCACGTCA
GGAACCGGATATTATGCAGAAGCTGGCCACGCTGCAGGCCGCCACGAAACGGGCGCTTTATGAAGCCATT
CTGTATCCTGGTGTGGATAATTTTGTGAAATATTTCCGGCTGCAGAATTACTGGACGCAGCAGGCGGGGC
TTTTCAGCATGAGCGCCAAAAAAGCCATGCTGGCGCATCCTGAACTGGACTATAACCTGCAGTACAGCCA
CTACAACGGCACGGTACGTAACCAGCTGGCCGCAGACCAGGCTCAGCAACGGCAGGCCATATCAAAGCTG
GCTGAACACTACGGTATCATGTTCTTTTACCGCGGGCAGGACCCCATTGACGGCCAGCTGGCGCAGGTGA
TTAATGGCTTTCGCGCCACTTACGGTCTGAGCGTTATCCCGGTGACCGTGGACGGGGTGATTAACCCGAT
GCTGCCGGATACGCGTCCTGACCAGGGGCAGGCGCAGCGTCTTGGTGTGAAATATTTCCCGGCCATGATG
CTGGTAGACCCGAAACAGGGCAGTGTCCGTCCGTTGTCATACGGGTTTATTACGCAGGACGACCTGGCAA
AACAGTTCCAGAATGTGTCAGAAGATTTTAAGCCGAATTTCTGA
 Primer design