SecReT4
Protein ID: 71559050
T4SS name [ID]Tra_F [132]
Gene symboltraN
Locus tagpOU1113_53
StrainSalmonella enterica plasmid pOU1113 (NC_007208)
Repliconplasmid pOU1113 [GenBank: NC_007208] [Browse all T4SS(s) in this replicon]
Location [Strand]43994..45817 [-]
Productconjugal transfer mating pair stabilization protein TraN
Component typeTraN_F
UniProt IDQ4L1T1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 2.9e-74, Aligned region: 313..557
Protein Sequence: 607 a.a.     [Download]
>gi|71559050|ref|YP_271777.1| conjugal transfer mating pair stabilization protein TraN [Salmonella enterica]
MKRMLPLFLLLAAGLAQADSNSDYRAGSDFAHQIKGQGTGSIRNFNPQESIPGYDANPDETKYYGGVTAG
GDSGLKNDGTTQWATGETGKTITESFMNKPKDILSPDAPFIEKGRDVVNRADSIVGNTGQQCSAQEINRS
EFTNYTCERDTTVEEYCTRTATITGDWRETSEVRTYTLTAFSFSVPVSRSFSSSRAEAGTISSASLNVTT
QNYLWNSRAGFMNTTFNMTWGSTITLGGATGMMLSKGQILSGTSCSGNGSCTGSVDDRIFNELTSGRTTF
TLTLVMQVKDREWIPRVEWVESCPFNKVDGVLKDTECTEPGGTKTGVMEGKPWSLAEACWAYRDKYVTQS
ADNGTCQAYVDNPACTLAARQCAFYSGESTCLHEYATYSCESKTAGKVMICGGDVFCLDGECDKAQSGKS
NDFGEAVSQLAALAAAGKDVAALNGIDVRAFTGQAKFCKKAAAGYSNCCKDSGWGQDIGLAKCSSDEKAL
AKAKTNKLTVSVGEFCSKKVLGVCLEKKRSYFQFDSKLAQIVQQQGRNGQLHISFGSSKHPDCRGITVDE
LQQIKFDQLDFTNFYEDLMNNQKIPDSGALTEKVKEQITDQLKQGGK
 
Nucleotide Sequence: 1824 bp     [Download]
>gi|71559001|ref|NC_007208.1|:c45817-43994 Salmonella enterica OU7025 plasmid pOU1113, complete sequence
ATGAAACGTATGTTACCTCTGTTTCTGCTTCTGGCCGCCGGCTTGGCACAGGCTGACAGTAACAGTGATT
ATCGTGCGGGTTCAGATTTTGCCCATCAGATCAAAGGCCAGGGCACCGGCAGTATCCGGAATTTTAATCC
TCAGGAGAGTATTCCCGGCTATGACGCGAATCCGGATGAAACGAAGTATTACGGTGGTGTGACCGCCGGC
GGCGACAGTGGGCTGAAGAATGACGGCACGACGCAGTGGGCCACAGGCGAAACCGGTAAAACCATTACAG
AATCGTTCATGAACAAGCCCAAAGATATTCTGTCACCGGATGCGCCGTTTATTGAAAAAGGAAGGGATGT
GGTGAACCGTGCCGACAGTATTGTGGGAAATACCGGGCAGCAGTGCAGCGCGCAGGAGATTAACCGCAGC
GAGTTCACGAATTATACCTGTGAACGCGACACCACTGTGGAGGAATACTGTACCCGGACGGCCACCATCA
CCGGCGACTGGAGAGAGACATCAGAGGTCAGAACCTACACCCTCACCGCCTTTAGTTTCAGCGTTCCGGT
AAGCAGATCGTTTTCATCGTCACGTGCCGAAGCAGGTACGATAAGCAGCGCCAGCCTGAATGTGACCACA
CAGAATTATCTGTGGAATTCCCGTGCCGGCTTTATGAATACCACCTTCAACATGACGTGGGGCAGTACCA
TTACACTGGGTGGCGCGACGGGAATGATGCTGAGCAAAGGCCAGATTCTGAGCGGGACAAGCTGCAGCGG
GAACGGTAGCTGTACCGGGTCGGTGGATGACCGCATTTTTAACGAGCTGACCAGCGGGAGGACGACGTTC
ACGCTGACACTGGTGATGCAGGTTAAGGACCGGGAGTGGATACCGCGGGTGGAGTGGGTGGAAAGCTGCC
CGTTCAACAAGGTGGATGGTGTTCTGAAAGATACCGAATGTACCGAACCCGGGGGAACGAAAACCGGGGT
GATGGAAGGAAAACCCTGGAGCCTGGCGGAGGCCTGCTGGGCATACCGGGATAAATATGTCACCCAGTCT
GCGGACAACGGCACCTGCCAGGCGTATGTCGATAATCCGGCCTGTACTCTTGCCGCCCGGCAGTGCGCGT
TTTACTCCGGTGAGAGCACCTGCCTGCATGAATACGCCACGTACTCCTGTGAGTCGAAAACTGCGGGAAA
GGTCATGATTTGTGGCGGGGATGTATTCTGCCTCGATGGGGAATGCGATAAGGCGCAGAGCGGAAAGAGC
AATGATTTTGGCGAGGCGGTATCGCAACTGGCGGCGCTGGCGGCGGCAGGTAAAGATGTCGCGGCCCTGA
ACGGTATTGACGTCCGTGCATTCACCGGACAGGCGAAATTCTGTAAGAAGGCCGCAGCCGGGTACAGCAA
CTGTTGTAAGGACAGTGGCTGGGGGCAGGATATCGGTCTGGCTAAATGCAGTAGTGACGAAAAAGCTCTG
GCCAAAGCAAAAACGAACAAACTGACGGTCAGTGTCGGGGAATTCTGTTCGAAAAAGGTACTGGGTGTCT
GTCTGGAGAAGAAACGGAGCTACTTCCAGTTTGATTCGAAGCTGGCGCAGATAGTCCAGCAGCAGGGGCG
CAACGGCCAGCTGCATATCAGTTTCGGCAGTTCAAAACATCCTGACTGCCGGGGTATCACCGTGGACGAA
CTACAGCAGATTAAATTCGACCAGCTGGACTTCACGAACTTCTACGAAGACCTGATGAATAACCAGAAAA
TACCGGACAGTGGCGCGCTGACGGAAAAGGTAAAAGAGCAGATTACTGACCAGCTGAAACAGGGCGGAAA
ATAA
 Primer design