SecReT4
Protein ID: 71559051
T4SS name [ID]Tra_F [132]
Gene symboltrbC
Locus tagpOU1113_54
StrainSalmonella enterica plasmid pOU1113 (NC_007208)
Repliconplasmid pOU1113 [GenBank: NC_007208] [Browse all T4SS(s) in this replicon]
Location [Strand]46268..46906 [-]
Productconjugal transfer pilus assembly protein TrbC
Component typeTrbC_F
UniProt IDQ4L1T0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 9.9e-28, Aligned region: 94..190
Protein Sequence: 212 a.a.     [Download]
>gi|71559051|ref|YP_271778.1| conjugal transfer pilus assembly protein TrbC [Salmonella enterica]
MHRKIKYLAGLIMVISGTVSAGGVANTPENRQFLKHQENLSSQLREKPDHQLKAWAEQQVQANPLVQSDR
HFLDDLARKQQTSQADKPEQGAVYFISFSIPEEGLKRMLGETRRYGIPATLRGMRDNDLKATADAVLSLV
KDGETDGVQIDPTLFTKYDIRSVPTLVVYCRQGYDVIRGNLRVKQALEKVVTAGDCRQVAAGLLDVAGDK
PQ
 
Nucleotide Sequence: 639 bp     [Download]
>gi|71559001|ref|NC_007208.1|:c46906-46268 Salmonella enterica OU7025 plasmid pOU1113, complete sequence
ATGCACAGGAAAATAAAATACTTGGCCGGACTGATTATGGTCATAAGCGGGACGGTATCAGCTGGCGGAG
TCGCTAATACCCCTGAAAATCGCCAGTTCCTGAAGCATCAGGAAAATTTAAGCAGCCAACTGCGTGAAAA
ACCGGACCATCAGCTGAAAGCCTGGGCAGAGCAGCAGGTACAGGCGAATCCCCTGGTGCAGTCAGACCGG
CATTTCCTGGATGACCTTGCCCGAAAGCAGCAGACTTCTCAGGCGGATAAACCGGAGCAGGGCGCGGTGT
ACTTTATCTCGTTTTCCATTCCGGAAGAGGGACTGAAGCGCATGCTGGGTGAAACCCGTCGCTACGGTAT
TCCGGCCACGCTGCGTGGAATGCGGGATAACGACCTGAAGGCCACGGCAGATGCCGTTCTGTCCCTGGTG
AAGGATGGGGAAACAGATGGTGTTCAGATTGACCCGACCCTGTTCACGAAATATGACATCCGCAGCGTAC
CGACTCTGGTGGTGTACTGCCGACAGGGATATGACGTTATCCGGGGCAATCTGCGGGTGAAGCAGGCGCT
GGAGAAAGTGGTCACCGCCGGGGACTGCAGGCAGGTGGCTGCCGGATTACTTGATGTTGCCGGAGATAAA
CCGCAATGA
 Primer design