SecReT4
Protein ID: 71559053
T4SS name [ID]Tra_F [132]
Gene symboltraU
Locus tagpOU1113_56
StrainSalmonella enterica plasmid pOU1113 (NC_007208)
Repliconplasmid pOU1113 [GenBank: NC_007208] [Browse all T4SS(s) in this replicon]
Location [Strand]47218..48210 [-]
Productconjugal transfer pilus assembly protein TraU
Component typeTraU_F
UniProt IDQ4L1S8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 6.3e-84, Aligned region: 29..329
Protein Sequence: 330 a.a.     [Download]
>gi|71559053|ref|YP_271780.1| conjugal transfer pilus assembly protein TraU [Salmonella enterica]
MKRSLWLCVLILLAGHVPTVSADSSCESRFVNPITDICWSCLFPLSLGSTKVSQGKLPDTANPSMPLQFC
PAPPPIFKRPGLAIGYWEPMALTDVTRSPGCMVNLGFSLPAFGKTAQGTAKKEDKQVNGAFYHVHWYKYP
LTYWLNIITSLGCLEGGDLDIAYLSEIDPTWTDSSLTTILNPEAVIFANPIAQGACAADAIASAFNKPLD
VLFWCAGSQGSMYPFNGWVSNESSPLQSSLLVSERMAFKLHRQGMIMETIGKNNAVCNEYPSPILPKERW
RYQMVNMYPDSGQCHPFGRSVMRWETGKNPPNTKKNFGYLMWRKRNCVFL
 
Nucleotide Sequence: 993 bp     [Download]
>gi|71559001|ref|NC_007208.1|:c48210-47218 Salmonella enterica OU7025 plasmid pOU1113, complete sequence
ATGAAACGGAGTCTGTGGCTGTGTGTACTGATTCTGCTGGCCGGTCATGTTCCCACGGTATCGGCTGATT
CCTCCTGTGAAAGTCGTTTTGTAAACCCGATCACGGATATCTGCTGGAGCTGTCTTTTTCCGCTGTCGCT
GGGCAGTACAAAAGTGAGTCAGGGAAAGCTGCCGGATACGGCTAATCCCTCAATGCCGCTCCAGTTCTGC
CCGGCGCCGCCGCCCATTTTTAAGCGTCCCGGACTGGCGATTGGCTACTGGGAGCCAATGGCGCTGACGG
ACGTCACCCGCTCTCCGGGCTGCATGGTGAATCTGGGGTTCAGCCTGCCGGCCTTCGGGAAAACGGCACA
GGGTACGGCGAAGAAGGAGGATAAACAGGTGAACGGGGCGTTCTACCATGTTCACTGGTACAAATACCCG
CTCACGTACTGGCTGAATATCATCACCTCGCTGGGGTGTCTGGAGGGCGGTGACCTGGACATTGCGTACC
TCTCCGAAATCGACCCCACGTGGACGGACAGCAGCCTGACCACCATTCTCAATCCGGAAGCGGTAATTTT
TGCCAATCCCATAGCTCAGGGGGCCTGCGCGGCAGATGCCATTGCCAGCGCCTTCAATAAACCGCTGGAT
GTCCTGTTCTGGTGTGCAGGCTCTCAGGGCTCCATGTATCCGTTTAACGGCTGGGTGAGTAACGAATCCA
GTCCGCTGCAGTCCTCCCTGCTGGTCAGTGAGCGGATGGCCTTCAAGCTTCACCGTCAGGGCATGATTAT
GGAAACCATCGGGAAAAATAACGCTGTCTGTAATGAATATCCGTCGCCCATTCTCCCTAAAGAGCGCTGG
CGTTATCAGATGGTGAATATGTACCCGGACAGCGGGCAGTGCCACCCGTTCGGACGCAGTGTGATGCGCT
GGGAAACCGGAAAAAATCCGCCCAACACGAAGAAGAACTTTGGCTATCTGATGTGGCGTAAGCGCAACTG
TGTATTTCTGTAA
 Primer design