SecReT4
Protein ID: 71559054
T4SS name [ID]Tra_F [132]
Gene symboltraW
Locus tagpOU1113_57
StrainSalmonella enterica plasmid pOU1113 (NC_007208)
Repliconplasmid pOU1113 [GenBank: NC_007208] [Browse all T4SS(s) in this replicon]
Location [Strand]48207..48839 [-]
Productconjugal transfer pilus assembly protein TraW
Component typeTraW_F
UniProt IDQ4L1S7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraW_N [PF12477], Evalue: 5.6e-09, Aligned region: 3..30
Protein Sequence: 210 a.a.     [Download]
>gi|71559054|ref|YP_271781.1| conjugal transfer pilus assembly protein TraW [Salmonella enterica]
MKWRGLTALLIWGQSVAAADLGTWGDLWPVQEPDMLAVIMHRLEALQQSGEMGHRMEAFKERVIHNSLRP
PAVPGIGRAEKYRSRLFDPSVRLAADIRDNEGRVFARQGEVMNPLQYVPFNQTLYFINGDDPEQVAWMKR
QTPPTLESKIILVQGSIPEMEKALDSRIYFDQNGVLCQRLGIDQVPGQGDGRNRRAFPESGVIPAEDGRK
 
Nucleotide Sequence: 633 bp     [Download]
>gi|71559001|ref|NC_007208.1|:c48839-48207 Salmonella enterica OU7025 plasmid pOU1113, complete sequence
ATGAAATGGCGGGGGCTGACAGCCCTGCTGATATGGGGGCAGAGCGTGGCGGCCGCAGACCTGGGTACCT
GGGGCGATCTGTGGCCGGTGCAGGAGCCGGACATGCTGGCGGTGATTATGCACCGGCTGGAAGCCCTGCA
GCAGTCCGGTGAGATGGGCCACCGGATGGAGGCCTTTAAGGAACGGGTAATCCACAACAGCCTGCGACCA
CCGGCGGTGCCGGGTATCGGGCGCGCGGAGAAATACCGCAGCCGGCTGTTTGATCCGTCGGTCAGACTGG
CGGCCGATATCCGGGATAACGAAGGTCGGGTGTTTGCCCGTCAGGGAGAGGTGATGAATCCGCTGCAGTA
TGTGCCTTTTAACCAGACGCTGTATTTCATTAACGGCGATGATCCGGAACAAGTGGCGTGGATGAAACGC
CAGACGCCGCCGACGCTGGAGAGCAAAATTATCCTGGTACAGGGCAGCATCCCTGAGATGGAGAAGGCGC
TGGACAGCCGGATTTACTTTGACCAGAACGGGGTGCTGTGTCAGCGCCTCGGGATCGACCAGGTGCCCGG
CCAGGGTGACGGCCGCAACAGACGGGCGTTTCCTGAAAGTGGAGTTATTCCGGCGGAGGACGGCAGAAAA
TGA
 Primer design