SecReT4
Protein ID: 71559056
T4SS name [ID]Tra_F [132]
Gene symboltraC
Locus tagpOU1113_59
StrainSalmonella enterica plasmid pOU1113 (NC_007208)
Repliconplasmid pOU1113 [GenBank: NC_007208] [Browse all T4SS(s) in this replicon]
Location [Strand]49188..51836 [-]
Productconjugal transfer ATP-binding protein TraC
Component typeTraC_F
UniProt IDQ4L1S5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 6.8e-58, Aligned region: 37..277
AAA_10 [PF12846], Evalue: 2.6e-44, Aligned region: 479..772
DUF87 [PF01935], Evalue: 4.3e-05, Aligned region: 482..668
TrwB_AAD_bind [PF10412], Evalue: 7.4e-05, Aligned region: 479..517
Protein Sequence: 882 a.a.     [Download]
>gi|71559056|ref|YP_271783.1| conjugal transfer ATP-binding protein TraC [Salmonella enterica]
MKNLLDTVTQAANSLLTALKLPDESAQANQILGEMSFPQFSRLLPYRDYNQESGLFMNDATMGFMLEATP
VNGANETIALSLDHLLRTKLPRGIPLCIHLMSSQLVGERIEYGLREFSWSGEQAERFNAITRAYYMKAAE
THFPLPEGMNLPLTLRHYRVFISYCAPSRKKSRADILEMENLVKIIRASLQGAYISTQTVDAQAFINIVG
EMINHNPESLHPTRRRLDPYSDLNYQCVDDSFDLKVRQDYLTLGLRDHGRNSTARIMSFHLARNPEIAFL
WNSADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLKKKSKTPTQMVPVREEGSRRSGKT
CASAWRRISPRRCPTFSISRRSAATTRKRRLETEQDILNSFRKNGFELISPRFNHMRNFLACLPFMAGKG
LFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSGA
GKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITNIDQSAERIRDQLSV
MASPNGNLDEVHEGLLLQAVRAAWLTKKNRARIDDVVDFLENARTSEQYAESPGIRSRLDEMIVLLNQYT
AAGTYGRYFNSDEPSLRDDARMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGWR
LLDFKNRKVGDFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKYN
QLYPDQFPQLHREMIEKFGARKNSGSSSFLLPGGKPFIWHRLFVDPLSRAMYSSDGSDFEFVQQKRKEGL
SIHEAVWQLAWKKSGPEMASLEAWLQEHETFRRTYEYRAETD
 
Nucleotide Sequence: 2649 bp     [Download]
>gi|71559001|ref|NC_007208.1|:c51836-49188 Salmonella enterica OU7025 plasmid pOU1113, complete sequence
GTGAAGAACCTGCTTGATACTGTCACTCAGGCGGCCAACTCGTTGCTGACCGCGCTGAAGCTGCCGGATG
AATCGGCACAGGCCAATCAGATCCTCGGCGAGATGAGCTTCCCGCAGTTCAGCCGTCTGCTGCCGTACCG
GGACTATAACCAGGAGTCCGGCCTGTTCATGAATGACGCCACGATGGGCTTTATGCTGGAAGCCACGCCT
GTCAACGGCGCTAACGAGACCATTGCGCTCTCCCTTGACCATCTGCTGCGTACCAAACTGCCGCGCGGGA
TACCCCTGTGTATCCACCTGATGTCCAGCCAGCTGGTCGGGGAGCGTATTGAGTACGGGCTGCGGGAGTT
CTCCTGGTCCGGTGAGCAGGCGGAGCGGTTCAACGCCATCACCCGCGCCTACTACATGAAAGCTGCAGAG
ACTCACTTTCCGTTGCCGGAAGGAATGAACCTGCCGCTGACCCTGCGCCATTACCGGGTATTCATCTCAT
ACTGCGCGCCGTCCAGAAAAAAAAGCCGGGCCGATATCCTGGAGATGGAAAACCTGGTGAAGATTATCCG
GGCCTCCCTGCAGGGGGCATACATCAGCACACAGACCGTGGATGCGCAGGCCTTTATTAATATTGTCGGG
GAGATGATTAATCACAATCCGGAATCCCTCCATCCGACCCGGCGCCGGCTGGACCCGTATTCCGACCTGA
ACTACCAGTGCGTGGACGACTCCTTTGACCTGAAGGTCAGGCAGGATTACCTGACGCTGGGACTGCGCGA
TCACGGGAGAAACAGTACCGCGCGCATCATGAGTTTTCATCTGGCCCGTAACCCAGAAATCGCCTTCCTG
TGGAACTCGGCGGATAATTACAGCAATCTGCTGAACCCGGAGCTGTCCATCTCCTGTCCGTTCATTCTGA
CGCTGACCCTGGTGGTGGAAGACCAGGTGAAGACCCACAGCGAAGCGAACCTGAAGTACATGGATCTGAA
GAAGAAGTCGAAGACTCCTACGCAAATGGTTCCCGTCCGTGAAGAAGGAAGCCGAAGGAGTGGGAAGACC
TGCGCCAGCGCCTGGCGTCGAATCAGTCCTCGGCGGTGTCCTACTTTTTCAATATCACGGCGTTCTGCCG
CGACAACAAGGAAACGGCGCTTGGAAACGGAGCAGGATATCCTGAACAGTTTCCGCAAGAACGGTTTTGA
GCTGATTTCGCCGCGCTTTAACCACATGCGTAATTTCCTGGCCTGCCTGCCCTTTATGGCCGGGAAGGGG
CTGTTTAAGCAGCTGAAGGAAGCCGGTGTGGTACAGCGGGCGGAGAGCTTCAATGTGGCCAATCTGATGC
CCCTGGTGGCGGATAACCCGCTAACTCCCGCCGGGCTGCTGGCTCCGACCTACCGTAACCAGCTGGCCTT
TATTGATATTTTCTTCCGGGGAATGAACAACACCAACTACAACATGGCGGTCTGCGGAACCTCCGGGGCG
GGCAAGACCGGACTGATACAGCCGCTTATCCGCAGCGTGCTGGATTCCGGCGGCTTTGCGGTGGTGTTTG
ACATGGGGGACGGGTACAAGTCCCTGTGCGAAAATATGGGCGGGGTGTACCTGGACGGGGAGACCCTGCG
TTTTAACCCCTTCGCCAATATCACCAATATTGACCAGTCGGCCGAACGTATCCGCGACCAGTTGTCGGTG
ATGGCCAGCCCCAACGGCAACCTTGACGAAGTCCATGAGGGCCTGTTGCTGCAGGCGGTCAGGGCAGCCT
GGCTGACAAAAAAGAACCGGGCGCGTATTGATGACGTGGTGGATTTTCTGGAAAACGCCCGCACGAGCGA
ACAGTATGCGGAGTCACCCGGTATCCGCAGCCGCTTGGATGAAATGATTGTCCTGCTGAACCAGTACACG
GCAGCAGGCACTTACGGCAGATACTTCAACTCCGATGAACCCTCCCTGCGCGATGATGCCAGGATGGTGG
TGCTGGAGCTGGGTGGCCTGGAAGACCGCCCGTCCCTGCTGGTTGCGGTGATGTTTTCCCTGATTATCTA
CATCGAAAACCGGATGTACCGCACGCCGCGTAACCTCAAAAAGCTGAACGTGATCGACGAAGGCTGGCGT
TTGCTGGACTTCAAAAACCGCAAGGTCGGGGACTTCATCGAAAAAGGCTACCGTACTGCCCGCCGTCACA
CCGGCGCGTATATCACCATCACGCAGAATATCGTCGACTTTGACTCCGACAAGGCGTCCAGCGCCGCCCG
CGCGGCATGGGGTAACTCTTCCTACAAAATTATCCTCAAACAGAGCGCCAAAGAATTCGCGAAATACAAC
CAGCTGTATCCGGATCAGTTCCCGCAGCTACACCGGGAGATGATTGAGAAATTCGGCGCGCGAAAGAACA
GTGGTTCCAGCTCGTTCCTGCTGCCAGGTGGAAAACCATTCATCTGGCACCGTCTGTTTGTCGACCCGCT
CAGCCGCGCCATGTACAGCTCGGACGGTTCTGACTTTGAGTTTGTACAGCAGAAGCGGAAAGAGGGGCTG
AGTATTCACGAGGCGGTCTGGCAACTGGCGTGGAAAAAGTCAGGACCGGAGATGGCCTCGCTGGAGGCCT
GGCTGCAGGAGCATGAGACATTCAGGAGGACGTATGAGTACAGAGCAGAAACAGACTGA
 Primer design