SecReT4
Protein ID: 71559059
T4SS name [ID]Tra_F [132]
Gene symboltraV
Locus tagpOU1113_62
StrainSalmonella enterica plasmid pOU1113 (NC_007208)
Repliconplasmid pOU1113 [GenBank: NC_007208] [Browse all T4SS(s) in this replicon]
Location [Strand]53048..53563 [-]
Productconjugal transfer protein TraV
Component typeTraV_F
UniProt IDQ4L1S2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 3.7e-37, Aligned region: 23..165
Protein Sequence: 171 a.a.     [Download]
>gi|71559059|ref|YP_271786.1| conjugal transfer protein TraV [Salmonella enterica]
MNHISCLIPFCGALLLSGCAGTNSDFECTATTSDTCMTMEQANEKAKRQEQPETVKPGAVSLPHLAEGNF
RTTPVQAVSTVTPPLGKTVIAPRSGQKPPALHPLFTAAREVKTVVPVSTASPVVPPRPLRTGEQTAALWI
APYIDSQDIYHQPSGVFFVIKPSVWGKPRIN
 
Nucleotide Sequence: 516 bp     [Download]
>gi|71559001|ref|NC_007208.1|:c53563-53048 Salmonella enterica OU7025 plasmid pOU1113, complete sequence
ATGAACCATATTTCATGCCTGATCCCTTTCTGTGGCGCGCTTTTGCTTTCCGGATGCGCCGGAACGAACT
CCGACTTTGAATGTACCGCCACCACGTCAGACACCTGTATGACGATGGAGCAGGCCAATGAAAAAGCGAA
AAGGCAGGAGCAACCTGAGACGGTAAAGCCGGGTGCGGTATCACTGCCGCACCTGGCTGAGGGTAACTTT
CGCACGACGCCGGTACAGGCCGTCAGTACCGTCACACCGCCCCTCGGAAAGACAGTGATCGCCCCGCGTT
CCGGGCAGAAACCGCCGGCACTACACCCGCTGTTTACAGCTGCCCGGGAGGTGAAAACGGTGGTGCCTGT
CAGTACGGCCTCTCCTGTGGTACCGCCCCGTCCACTGAGAACCGGGGAGCAGACGGCGGCGTTATGGATA
GCGCCCTATATTGACAGCCAGGATATTTACCATCAGCCGTCCGGTGTATTTTTTGTCATTAAACCGTCCG
TGTGGGGAAAGCCACGGATTAATTAA
 Primer design