SecReT4
Protein ID: 71725274
T4SS name [ID]VirB [459]
Gene symbol-
Locus tagPSPPH_B0028
StrainPseudomonas syringae pv. phaseolicola 1448A
Repliconplasmid small plasmid [GenBank: NC_007275] [Browse all T4SS(s) in this replicon]
Location [Strand]21475..24027 [+]
Productconjugal transfer protein
Component typeVirB4
UniProt IDQ48B13
KEGG IDpsp:PSPPH_B0028
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 3.7e-23, Aligned region: 162..357
AAA_10 [PF12846], Evalue: 6e-15, Aligned region: 426..714
Protein Sequence: 850 a.a.     [Download]
>gi|71725274|ref|YP_272283.1| conjugal transfer protein [Pseudomonas syringae pv. phaseolicola 1448A]
MAHDFHKSVMPPEKKVPLMRYPVHEHMVTLPGNRLVSLIQLKGVSSETRSDDELIQLFNNLNRYFLALGK
KEGKHLMLQTYITKTGIELDTQYTLPLPALQDFVDAYTAPFRNGTFYQVGYSIALILKYREVDEGIERMS
DLLSLSSTLLAEYDPVIMGLEENEHDALFSQIGRYYSLLINGHEKDVLVSDTRLGDAIIDSVTNFENYDF
VENRPNRGGQRFATTFDLRDYPSGGTYPGMWDEAIEQQFEFTLVQTFLFEDRNKAKDKFKKHVADLGSVE
RDSRQTEELENAIDAITLGDKAFGRYHASLIVYGKTPDQAIENGTKMASVFTVRDATFVRSTMSNIDTWY
TQFPGVTEALYPMMKSTENLACSFSLHSTPTGKVRGNPIGDGTGLMPVLTVNKALYVLNVHDSPPGQNNL
GEMLPGHAVYTGQTGVGKTTAEATLLTFLSRFDPLIFGIDYNESLRHLLCALGAEYYTVQPGHFTGVNPF
QFHDSPGLRQMLIDLVLCCAGGPDKSDEADQRTIKDSVEAVMAHTNVRLRGMSLLLQNIPLRGGNCLHTR
LSKWCRLAGEGREGQYAWVLDSPINQFNAQTYRRLAFDCTQLLKNDYADKHPEVMEAFLNTLFYMKREMH
EARPGNLLLNVVAEYWAPLSFKSTADAIKEVLQSGRMRGEILIMDTQYPEQALATPYAAAVIQQVITPIW
LPNKNAQAESYAKFGVTGKLFEAVRDMGPLSREMVVQQGHQTVKLKMELDGPLKYWLPLLSATQKNLAVA
ERIRQHLRTTDPTVWVDAFLVAEAVRQWLNTDDPAVWLPAFDYADNLRQSMKTRDAQRWMPAFQKAWKAL
QEQNEIEVSS
 
Nucleotide Sequence: 2553 bp     [Download]
>gi|71725269|ref|NC_007275.1|:21475-24027 Pseudomonas syringae pv. phaseolicola 1448A small plasmid, complete sequence
ATGGCGCACGATTTTCACAAAAGCGTTATGCCCCCGGAAAAGAAAGTGCCATTGATGCGCTATCCGGTCC
ACGAACACATGGTGACACTGCCCGGCAACCGCCTGGTGAGTCTGATCCAGTTGAAAGGGGTTTCCAGCGA
AACCCGCAGTGATGACGAACTGATCCAACTGTTCAACAACCTCAACCGCTACTTCCTGGCCCTGGGCAAA
AAGGAAGGCAAGCACCTGATGCTGCAAACCTACATCACCAAGACGGGCATCGAGCTGGACACGCAATACA
CGTTGCCGCTGCCCGCCCTTCAGGATTTTGTGGACGCTTACACCGCACCGTTTCGCAACGGCACCTTCTA
CCAGGTGGGGTACAGCATTGCCCTGATCCTCAAGTACCGCGAGGTGGATGAAGGGATCGAGCGTATGAGC
GACCTGTTGTCACTTTCCTCTACGTTGCTGGCCGAATATGACCCAGTCATCATGGGGCTGGAGGAAAACG
AACACGATGCATTGTTCTCCCAGATCGGGCGCTACTACAGCCTGCTGATCAACGGGCACGAAAAAGACGT
GCTGGTCAGCGACACCCGCCTGGGTGACGCGATCATTGATAGTGTCACCAACTTCGAAAACTACGATTTC
GTCGAGAACCGGCCCAATCGGGGTGGCCAGCGTTTCGCGACCACCTTTGACCTGCGCGACTACCCCAGTG
GCGGGACCTACCCCGGCATGTGGGACGAAGCTATCGAGCAGCAGTTCGAGTTCACCCTGGTGCAAACATT
TCTGTTCGAAGACCGTAACAAGGCCAAGGACAAATTCAAAAAGCACGTGGCGGATCTGGGCTCGGTCGAG
CGCGATTCCAGGCAGACCGAGGAGCTTGAAAATGCCATCGATGCCATCACCCTGGGTGACAAGGCGTTTG
GTCGCTATCACGCTTCCCTGATCGTCTACGGCAAGACCCCGGACCAGGCCATCGAGAACGGCACAAAAAT
GGCGTCGGTGTTTACGGTGCGTGACGCGACTTTCGTGCGTTCGACCATGAGCAACATCGACACCTGGTAC
ACGCAGTTCCCGGGTGTGACCGAGGCCCTGTACCCGATGATGAAATCGACCGAGAACCTGGCGTGCAGCT
TTTCCCTGCACTCCACCCCCACGGGCAAGGTCAGGGGAAACCCCATTGGCGATGGAACAGGGCTGATGCC
GGTGCTGACGGTCAACAAGGCGTTGTATGTCCTCAACGTGCATGACAGCCCGCCTGGCCAGAACAACCTC
GGTGAAATGCTGCCAGGTCATGCGGTCTACACAGGCCAAACGGGGGTCGGTAAAACCACCGCTGAGGCCA
CCCTGCTGACCTTTCTCAGCCGCTTCGATCCGCTGATCTTCGGCATCGACTACAACGAGTCTTTGAGACA
TCTGCTGTGTGCATTGGGGGCTGAGTATTACACCGTGCAGCCTGGTCACTTCACCGGCGTCAACCCGTTC
CAGTTTCACGACAGTCCGGGGTTGCGGCAAATGCTGATCGACCTGGTGCTGTGCTGCGCGGGTGGCCCTG
ACAAGAGCGATGAGGCCGATCAGCGCACGATCAAGGATTCGGTCGAAGCAGTCATGGCGCACACCAATGT
GCGCCTTCGGGGCATGTCGCTGCTGCTGCAGAACATCCCCCTCCGGGGTGGCAATTGCCTGCACACCCGG
CTATCGAAATGGTGCCGTCTGGCCGGTGAAGGCCGTGAAGGGCAATACGCCTGGGTACTGGATTCGCCGA
TCAACCAGTTCAATGCGCAGACCTACCGGCGTCTGGCCTTTGACTGCACGCAGCTGCTCAAGAACGACTA
CGCCGACAAGCACCCCGAGGTCATGGAAGCGTTTCTGAACACGTTGTTCTACATGAAACGCGAAATGCAC
GAAGCCCGCCCCGGGAATCTGTTGCTCAACGTGGTGGCCGAGTACTGGGCACCCCTGTCCTTCAAAAGCA
CAGCGGACGCAATCAAGGAGGTCTTGCAAAGCGGACGTATGCGCGGGGAAATCCTGATCATGGACACCCA
GTACCCCGAGCAAGCACTGGCGACGCCTTACGCAGCAGCCGTCATTCAGCAGGTGATTACGCCCATCTGG
CTGCCCAACAAGAACGCCCAGGCCGAGAGTTACGCCAAGTTCGGTGTCACGGGCAAGCTGTTTGAGGCCG
TGCGTGACATGGGACCGCTGAGCCGGGAAATGGTGGTCCAGCAGGGTCACCAGACGGTGAAGCTGAAAAT
GGAGCTGGACGGCCCACTCAAGTACTGGTTGCCGCTGTTATCTGCCACCCAAAAGAATCTGGCGGTGGCC
GAGCGCATTCGGCAACACCTGCGCACGACCGATCCCACGGTGTGGGTCGATGCGTTCCTGGTGGCCGAAG
CGGTACGCCAATGGCTCAACACCGACGACCCCGCTGTATGGCTGCCCGCGTTCGACTACGCCGACAACCT
GCGCCAGTCCATGAAAACGCGGGATGCACAGCGCTGGATGCCGGCGTTTCAAAAAGCCTGGAAAGCCCTT
CAGGAACAGAATGAAATTGAGGTTTCGTCATGA
 Primer design