SecReT4
Protein ID: 71725285
T4SS name [ID]VirB [459]
Gene symbol-
Locus tagPSPPH_B0029
StrainPseudomonas syringae pv. phaseolicola 1448A
Repliconplasmid small plasmid [GenBank: NC_007275] [Browse all T4SS(s) in this replicon]
Location [Strand]24024..24710 [+]
Productconjugal transfer protein
Component typeVirB5
UniProt IDQ48B12
KEGG IDpsp:PSPPH_B0029
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 1.1e-41, Aligned region: 28..211
Protein Sequence: 228 a.a.     [Download]
>gi|71725285|ref|YP_272284.1| conjugal transfer protein [Pseudomonas syringae pv. phaseolicola 1448A]
MKKHAIACALSALMLTAALPAAHAAVPGVPVLDPSTLLALKVNALAQAKQAMDALSTAKEAISETAKQYN
HYKGIITGNDMLGGFLNDPALNRVMPMGDWAEVYSTGRDIVSLRDRYGLTSDNASVQAKFDQMMAAADAL
ERNYKASTERVKNAEMLRSRLNEVTTPQQKQDLQLRYQQELIEQQNQQMRLANMQMLQQQQEKMENEKRA
QAFSDYMNGKTNVRPSYE
 
Nucleotide Sequence: 687 bp     [Download]
>gi|71725269|ref|NC_007275.1|:24024-24710 Pseudomonas syringae pv. phaseolicola 1448A small plasmid, complete sequence
ATGAAAAAACACGCGATTGCTTGTGCGCTGAGCGCGCTCATGTTGACCGCAGCCCTGCCGGCTGCTCACG
CGGCAGTACCAGGCGTTCCGGTCCTGGACCCGTCTACCCTTCTCGCGTTGAAGGTGAATGCGTTAGCCCA
GGCCAAGCAGGCTATGGACGCGCTGAGCACGGCCAAGGAGGCCATCAGCGAGACCGCAAAGCAGTACAAC
CATTACAAAGGCATCATCACCGGCAACGACATGCTGGGCGGCTTCCTGAACGACCCGGCCTTGAACAGGG
TCATGCCCATGGGTGACTGGGCCGAGGTGTACAGCACGGGCCGGGATATCGTCAGTCTGCGTGACCGTTA
CGGCTTAACCTCGGATAATGCCAGTGTGCAGGCGAAATTCGACCAGATGATGGCGGCTGCCGATGCGCTG
GAGCGCAATTACAAAGCCAGCACTGAACGTGTCAAGAACGCCGAGATGCTTCGGTCCCGGTTAAACGAGG
TGACGACCCCACAGCAGAAGCAGGATTTACAGCTGCGCTACCAGCAGGAGCTGATCGAGCAACAAAACCA
GCAGATGCGGCTGGCCAACATGCAGATGCTCCAGCAGCAGCAAGAGAAGATGGAAAACGAAAAACGGGCC
CAGGCGTTCAGTGATTACATGAACGGTAAAACTAATGTTCGGCCCAGCTACGAGTGA
 Primer design