SecReT4
Protein ID: 71725287
T4SS name [ID]VirB [459]
Gene symbol-
Locus tagPSPPH_B0035
StrainPseudomonas syringae pv. phaseolicola 1448A
Repliconplasmid small plasmid [GenBank: NC_007275] [Browse all T4SS(s) in this replicon]
Location [Strand]28015..29415 [+]
Productconjugal transfer protein
Component typeVirB10
UniProt IDQ48B06
KEGG IDpsp:PSPPH_B0035
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 3.1e-46, Aligned region: 280..459
Protein Sequence: 466 a.a.     [Download]
>gi|71725287|ref|YP_272290.1| conjugal transfer protein [Pseudomonas syringae pv. phaseolicola 1448A]
MQNNENDQAPENTQGTTAQPDSIGPPEPAAGQAAATEQSPAPEQAPASEPASTQARGAFDVRAKRTGDAQ
NKKTLYLGLAVLVLVGLLGIAALWYATISQMKTTGSEVDETNVKKDATLDVNLGSDDSMKKAREAKLAAD
KAEEERRARAESERLAKEQKDAEDARRGSSGQGNVASAPPPPGTPGQNPPVEQTPRQRKLGAAMFVTSED
ALGTGAADTQPQQPSTNQPSGMPSLLDGIPGGSSSDLGGEASNRKRSSLSNLGGTTFAPAKAYLAPNRKY
LVSHNTYTRCALYTEIISTHPGLVDCRLTDPLYSADGSTVIAEAGDKLTGEQTVEVGPGETSVFTTWTEL
ETRSGARAKLDSLGAGPMGASGTEAWINRHYMQRFGGAVMLSFIQDALQAASNTTQKSSGTGGYTVNNSE
QNVESMANKALDSTINIPDTAHLLPGTVITVIVARDIDFSSVFENR
 
Nucleotide Sequence: 1401 bp     [Download]
>gi|71725269|ref|NC_007275.1|:28015-29415 Pseudomonas syringae pv. phaseolicola 1448A small plasmid, complete sequence
ATGCAGAACAATGAAAATGACCAGGCTCCTGAGAACACTCAAGGGACCACCGCCCAGCCAGACAGCATCG
GGCCGCCCGAACCCGCAGCTGGTCAAGCGGCGGCCACGGAGCAATCCCCGGCCCCGGAACAGGCACCGGC
CTCCGAGCCCGCCAGCACCCAGGCCCGTGGGGCCTTTGACGTGCGGGCCAAGCGCACAGGCGATGCCCAG
AACAAGAAGACGCTTTATCTTGGCCTGGCTGTGCTGGTGTTAGTGGGGCTGCTGGGTATTGCCGCGCTTT
GGTACGCCACCATTTCCCAGATGAAAACCACCGGCTCCGAGGTCGATGAAACCAACGTCAAGAAGGACGC
GACCCTGGACGTGAATCTGGGCAGCGACGACAGCATGAAAAAGGCACGTGAAGCCAAGCTGGCCGCTGAC
AAAGCCGAAGAGGAACGGCGAGCCCGAGCTGAAAGCGAGCGATTGGCCAAAGAGCAAAAAGACGCTGAGG
ACGCTCGGCGAGGTTCATCCGGTCAGGGCAACGTCGCCAGTGCGCCGCCCCCTCCCGGCACGCCGGGTCA
GAACCCGCCCGTGGAACAGACTCCCCGGCAACGCAAACTGGGGGCTGCGATGTTCGTCACCTCGGAAGAT
GCATTGGGCACCGGCGCTGCGGATACACAGCCGCAACAGCCGTCCACCAATCAGCCCTCTGGGATGCCTT
CACTACTGGACGGCATTCCAGGCGGATCGAGCAGCGACCTGGGCGGTGAAGCGTCCAACAGAAAACGCAG
TAGCCTGAGCAACCTGGGCGGCACCACCTTTGCCCCGGCCAAGGCGTACCTGGCACCGAACCGCAAATAC
CTGGTCAGCCACAACACCTACACGCGCTGCGCGCTGTACACCGAAATCATCAGCACCCACCCAGGGCTGG
TGGATTGTCGTCTGACCGATCCGTTGTATTCCGCCGATGGCTCCACGGTGATTGCGGAGGCCGGAGACAA
GCTCACCGGTGAACAGACGGTTGAGGTTGGGCCAGGCGAAACCAGCGTGTTCACCACCTGGACAGAGCTT
GAAACCCGATCGGGTGCGCGGGCCAAGCTGGACAGCCTCGGTGCAGGCCCCATGGGAGCCAGCGGGACCG
AAGCCTGGATCAATCGCCACTACATGCAGCGCTTTGGCGGTGCGGTGATGTTGTCGTTCATCCAGGACGC
GCTCCAGGCCGCATCCAACACCACGCAGAAAAGCTCAGGAACCGGGGGTTACACGGTGAACAACAGCGAG
CAGAACGTGGAGAGCATGGCCAACAAGGCGCTGGACAGCACCATCAACATTCCGGATACCGCACACCTGC
TGCCGGGCACCGTGATCACCGTCATCGTGGCCCGCGACATCGACTTTTCATCGGTTTTCGAGAACCGCTA
A
 Primer design