SecReT4
Protein ID: 71725288
T4SS name [ID]VirB [459]
Gene symbol-
Locus tagPSPPH_B0031
StrainPseudomonas syringae pv. phaseolicola 1448A
Repliconplasmid small plasmid [GenBank: NC_007275] [Browse all T4SS(s) in this replicon]
Location [Strand]25107..26042 [+]
Productconjugal transfer protein
Component typeVirB6
UniProt IDQ48B10
KEGG IDpsp:PSPPH_B0031
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2.6e-37, Aligned region: 42..268
Protein Sequence: 311 a.a.     [Download]
>gi|71725288|ref|YP_272286.1| conjugal transfer protein [Pseudomonas syringae pv. phaseolicola 1448A]
MDVTKIAQTLFGFVDAALQSTLVTGMAKVMLGVGALFGTMWLIHFTLRNMQWLYRGMNVAFEDVAKEIAK
MAAITACAFNLQWYVQTIVPFVTGFPNWMGGILSGQEGTQTNQIDSLIVVYGANLKALIGAMNFDIFGTS
FSVIWLGIQGVVFYVLGGIPFLLAAVATLFVLKVSTTAVVAVGPLFIAFLLFDQTKQYFWGWVAAIAGFM
LAQVLISVVLAIEIGFINTVMIKDGTLTTTLEGNLTILIVFCTFTALVIELPQQAASIMGGGPSGGGLIG
KISGFSAARSMTRGVAAGISKMRGAGRNKVS
 
Nucleotide Sequence: 936 bp     [Download]
>gi|71725269|ref|NC_007275.1|:25107-26042 Pseudomonas syringae pv. phaseolicola 1448A small plasmid, complete sequence
ATGGACGTAACAAAGATAGCCCAGACGTTGTTTGGTTTCGTTGATGCCGCCCTGCAAAGCACCTTGGTCA
CCGGGATGGCCAAGGTGATGCTGGGGGTTGGAGCGCTCTTCGGAACCATGTGGTTGATCCACTTTACCCT
TCGCAATATGCAGTGGCTGTACCGGGGCATGAACGTTGCCTTCGAAGATGTGGCCAAAGAAATCGCAAAA
ATGGCTGCCATCACGGCGTGTGCATTTAATCTGCAATGGTACGTACAGACGATTGTGCCCTTTGTCACCG
GCTTCCCCAACTGGATGGGGGGAATCCTGTCCGGTCAGGAGGGTACGCAAACCAACCAGATCGACAGCTT
GATCGTTGTTTACGGTGCCAACCTGAAAGCTCTGATAGGGGCTATGAATTTCGATATCTTCGGTACCAGT
TTTTCTGTTATTTGGTTGGGGATCCAGGGGGTGGTGTTTTATGTGCTGGGCGGTATCCCGTTCTTGCTGG
CCGCCGTCGCCACGCTCTTTGTCCTGAAAGTCTCGACAACGGCTGTTGTGGCCGTAGGGCCTCTGTTCAT
CGCCTTTCTGCTGTTCGATCAGACCAAGCAGTACTTCTGGGGATGGGTTGCAGCCATCGCGGGCTTTATG
TTGGCTCAAGTTCTGATATCGGTTGTGCTGGCTATCGAGATTGGTTTTATCAACACCGTGATGATTAAAG
ACGGAACGTTGACGACCACCCTGGAGGGGAATCTCACCATCCTGATAGTCTTCTGCACGTTCACGGCTCT
GGTCATCGAACTGCCTCAGCAAGCAGCCTCGATCATGGGCGGCGGCCCTTCCGGGGGCGGACTGATCGGC
AAAATTTCAGGGTTTAGTGCAGCAAGAAGCATGACCCGTGGTGTCGCCGCCGGCATTTCCAAAATGCGGG
GGGCAGGTCGCAACAAAGTCTCTTAA
 Primer design