SecReT4
Protein ID: 71725291
T4SS name [ID]VirB [459]
Gene symbol-
Locus tagPSPPH_B0036
StrainPseudomonas syringae pv. phaseolicola 1448A
Repliconplasmid small plasmid [GenBank: NC_007275] [Browse all T4SS(s) in this replicon]
Location [Strand]29425..30456 [+]
Productconjugal transfer protein
Component typeVirB11
UniProt IDQ48B05
KEGG IDpsp:PSPPH_B0036
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 7.2e-39, Aligned region: 24..317
Mg_chelatase [PF01078], Evalue: 3.9e-05, Aligned region: 150..198
Protein Sequence: 343 a.a.     [Download]
>gi|71725291|ref|YP_272291.1| conjugal transfer protein [Pseudomonas syringae pv. phaseolicola 1448A]
MTQEQGLTEDTLVLDFLDQAGVTERLNRPGTKDVAINRPYELWVDGPKGWQYEEAPWLTYSLCWRLANAL
CALNYRVLAPHSPIHTVELPGGERGQIVMAPACEKGTLSTTFRKPSLDRFTHMDYVNSGRYDRARAIASP
VLTLKAWQRDMQEAHAAGHWHQFMEIAIANRQNIIIFGGPGSGKTTYGKSLIDMFPVNRRMITIQEILED
PMPFHPNHVHLLYGHVVSPKALVASALRMKPDHLFLAELTGDEVWHFIEILNTGTKGTVTTAHANDSEAG
YARVCGLVKQSEVGKGLDYDYIERLVRTSFDVVVYMENTYIEEVHYEPEHKLALLNGQRQRAA
 
Nucleotide Sequence: 1032 bp     [Download]
>gi|71725269|ref|NC_007275.1|:29425-30456 Pseudomonas syringae pv. phaseolicola 1448A small plasmid, complete sequence
ATGACGCAAGAACAAGGACTCACCGAAGACACGCTTGTCCTGGACTTTCTCGACCAGGCAGGCGTCACCG
AGCGCCTGAATCGTCCAGGCACCAAGGACGTGGCCATCAACCGGCCTTACGAACTGTGGGTGGACGGTCC
AAAGGGCTGGCAATATGAAGAAGCGCCCTGGCTCACCTACAGCTTGTGTTGGCGGCTGGCCAACGCACTT
TGCGCGCTGAACTACCGCGTACTGGCTCCGCATTCACCGATTCACACGGTGGAACTGCCTGGCGGGGAGC
GGGGCCAGATCGTCATGGCGCCGGCGTGCGAAAAGGGCACTCTTTCGACGACGTTTCGAAAACCTTCCCT
GGATCGCTTCACGCATATGGATTACGTCAACAGTGGCCGCTATGACCGGGCCAGGGCCATCGCTTCACCG
GTACTGACCCTGAAAGCCTGGCAGCGCGACATGCAGGAGGCCCACGCGGCTGGCCACTGGCACCAGTTCA
TGGAAATCGCCATCGCTAATCGCCAGAACATCATCATTTTTGGCGGGCCAGGCTCGGGTAAAACCACCTA
CGGCAAGTCGCTGATCGACATGTTTCCGGTTAACCGTCGCATGATCACTATTCAGGAAATACTGGAAGAC
CCCATGCCCTTTCATCCCAACCATGTGCATCTGCTCTATGGCCATGTGGTTTCACCTAAAGCCCTGGTGG
CCAGCGCGCTGCGGATGAAGCCCGACCACCTGTTTCTGGCCGAGCTGACGGGTGATGAGGTGTGGCATTT
CATCGAGATTTTGAACACTGGCACAAAGGGCACCGTGACCACTGCGCATGCCAACGACAGTGAAGCAGGC
TACGCCCGTGTGTGTGGTCTGGTGAAGCAGTCGGAGGTCGGCAAGGGCCTGGATTACGACTACATCGAAC
GCCTGGTACGCACCTCGTTCGATGTGGTGGTGTACATGGAAAACACCTACATCGAGGAAGTGCATTACGA
GCCTGAACACAAGCTGGCCTTGCTCAATGGCCAGCGTCAACGCGCTGCCTAG
 Primer design