SecReT4
Protein ID: 71725295
T4SS name [ID]VirB [459]
Gene symbol-
Locus tagPSPPH_B0041
StrainPseudomonas syringae pv. phaseolicola 1448A
Repliconplasmid small plasmid [GenBank: NC_007275] [Browse all T4SS(s) in this replicon]
Location [Strand]33866..35518 [+]
Productconjugal transfer protein
Component typeVirD4
UniProt IDQ48B00
KEGG IDpsp:PSPPH_B0041
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 8.9e-78, Aligned region: 14..468
TraG-D_C [PF12696], Evalue: 2.9e-27, Aligned region: 309..431
TrwB_AAD_bind [PF10412], Evalue: 2.6e-21, Aligned region: 254..448
Protein Sequence: 550 a.a.     [Download]
>gi|71725295|ref|YP_272296.1| conjugal transfer protein [Pseudomonas syringae pv. phaseolicola 1448A]
MAKAKSQPISPTNPQKRIDEHPAFLLGKHPTEDSFLASYGQQFVMLAAPPGSMKGVSAVIPNLLSYPDSM
VVNDPKFENWDITSGFRASAGHKVCRFSPERLETHRWNPVSAISRDPLYRLGDIRTLARVLFVSDNPKNQ
EWYNKAGNVFSSILLYLMETPAMPCTLPQTYEIGSLGTGMGTWAQQVIELRSTGPNALTVETLRELNGVF
EASKNKSSGWSTTVDIVRDVLSVYAEKTVAWAVSGDDIDFAKMREEKTTVYFSVTEGNLKKYGPLMNLFF
TQAIRLNSKVIPEQGGNCADGTLRYKYQLALMMDEFAIMGRMEIMETAPALTRGAGLRFFLIFQGKDQIR
AIYGEEAANGIMKAIHNEIVFAPGDIKLAEEYSRRLGNTTVRVHNQSLNRQKHEVGARGQTDSYSEQPRP
LMLPQEVNELPFDQQLIFVQGNRQTEPMKILARKIIYFEEEVFIARQKMTPPPLPVGDASKIDALTVPVR
TLKATVAVADTKPMQAEQRQRWNPKDTASKPVQVEADKAQPPEVEPDPEPAQTDDTLETM
 
Nucleotide Sequence: 1653 bp     [Download]
>gi|71725269|ref|NC_007275.1|:33866-35518 Pseudomonas syringae pv. phaseolicola 1448A small plasmid, complete sequence
ATGGCCAAAGCCAAATCGCAACCCATCAGCCCGACCAACCCACAAAAACGGATCGATGAACACCCCGCGT
TCCTGCTCGGCAAGCACCCCACGGAAGATTCGTTTCTGGCCAGCTACGGGCAACAGTTCGTGATGCTGGC
AGCGCCCCCTGGTTCGATGAAGGGTGTCAGTGCGGTGATCCCCAACCTGTTGAGCTACCCCGATTCGATG
GTGGTCAACGATCCGAAGTTTGAAAACTGGGATATCACCTCAGGCTTTCGCGCCTCAGCTGGCCACAAGG
TGTGTCGCTTTTCACCTGAGCGCCTGGAGACGCACCGCTGGAATCCGGTCAGTGCCATTAGCCGAGACCC
GCTGTACCGGCTAGGCGATATTCGTACCCTCGCTCGCGTATTGTTCGTCTCCGACAACCCCAAGAATCAG
GAGTGGTACAACAAGGCCGGCAACGTTTTTTCATCCATCCTGCTGTACCTGATGGAAACGCCGGCCATGC
CGTGTACGTTGCCCCAAACCTACGAAATTGGCTCATTGGGCACCGGGATGGGGACATGGGCTCAGCAGGT
CATCGAGCTGCGCAGCACCGGCCCTAATGCACTCACCGTTGAAACCCTGCGTGAATTGAATGGTGTGTTC
GAGGCCTCGAAAAACAAGAGCAGCGGTTGGTCCACCACCGTGGATATCGTGCGTGACGTGCTGTCGGTGT
ATGCCGAAAAAACGGTGGCTTGGGCGGTGTCAGGTGACGACATCGACTTTGCCAAAATGCGCGAGGAGAA
GACCACCGTTTATTTCAGTGTGACGGAAGGAAACCTGAAGAAGTACGGCCCGCTGATGAACCTGTTCTTC
ACTCAGGCCATACGGCTCAACTCCAAAGTCATTCCTGAGCAAGGCGGGAACTGTGCAGACGGTACGCTTC
GGTACAAATACCAACTGGCCCTGATGATGGACGAATTCGCCATCATGGGCCGCATGGAAATCATGGAAAC
CGCGCCTGCACTGACCCGAGGTGCAGGTCTGAGGTTTTTCCTCATCTTCCAGGGCAAGGATCAGATCCGC
GCTATTTATGGCGAGGAAGCGGCCAACGGCATCATGAAGGCGATTCACAACGAAATCGTGTTCGCCCCTG
GTGATATCAAGCTGGCCGAGGAGTACAGCAGGCGCTTGGGCAATACCACCGTGCGCGTCCATAACCAGTC
GTTGAACAGGCAGAAACACGAGGTAGGTGCTCGAGGCCAAACAGACAGTTACAGCGAGCAGCCCCGGCCC
TTGATGCTCCCCCAGGAGGTGAACGAGTTACCTTTCGACCAACAATTGATTTTTGTCCAAGGCAACCGGC
AGACAGAGCCAATGAAAATCCTGGCCCGCAAGATCATTTACTTCGAAGAGGAGGTGTTTATAGCGCGACA
GAAGATGACGCCTCCGCCGTTGCCGGTCGGAGACGCTTCTAAAATCGACGCGCTCACCGTGCCGGTGCGC
ACCCTGAAAGCCACGGTGGCAGTGGCCGACACCAAGCCCATGCAGGCCGAACAGCGGCAGCGCTGGAACC
CCAAAGACACCGCGTCCAAACCCGTCCAGGTCGAAGCGGACAAGGCTCAGCCCCCCGAGGTCGAGCCGGA
TCCCGAGCCTGCGCAGACTGACGATACCCTCGAAACGATGTAA
 Primer design