SecReT4
Protein ID: 71725308
T4SS name [ID]VirB [459]
Gene symbol-
Locus tagPSPPH_B0033
StrainPseudomonas syringae pv. phaseolicola 1448A
Repliconplasmid small plasmid [GenBank: NC_007275] [Browse all T4SS(s) in this replicon]
Location [Strand]26441..27229 [+]
Productconjugal transfer protein
Component typeVirB8
UniProt IDQ48B08
KEGG IDpsp:PSPPH_B0033
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.9e-47, Aligned region: 42..255
Protein Sequence: 262 a.a.     [Download]
>gi|71725308|ref|YP_272288.1| conjugal transfer protein [Pseudomonas syringae pv. phaseolicola 1448A]
MKKLRKSKQDVIEQERQLAARTSIDAATAQEISLAEQAFTHAARFFEKNIAAEEKAKTKNARRLAGFFGV
LTFMSIAAVLGLTPLKTVQLGLVRVDTNSGYTDVVWAENKGKPPEQIDDEFWLSSYVRFRESYNFSSHDA
EFGMVELMSYGETFTEYRNFQLSSKGYLEVLGTNRQIRTDINNINFLERKDRAGTAQVRITKTVLDRNGT
PDPQLAPVTWVATVTYDYNNPAKKAGDQWLNPRGFGVKAYTMTQEVGVSNGK
 
Nucleotide Sequence: 789 bp     [Download]
>gi|71725269|ref|NC_007275.1|:26441-27229 Pseudomonas syringae pv. phaseolicola 1448A small plasmid, complete sequence
ATGAAAAAGCTTCGAAAATCCAAACAGGACGTGATCGAGCAGGAGCGGCAACTGGCCGCCCGTACCAGCA
TCGATGCGGCCACCGCACAAGAAATCAGCCTGGCTGAGCAGGCCTTTACCCACGCAGCGCGGTTTTTCGA
GAAGAACATCGCCGCCGAAGAGAAGGCCAAGACCAAAAACGCCCGTCGCCTGGCGGGCTTCTTCGGTGTG
CTGACCTTCATGTCGATCGCCGCCGTGCTGGGCCTGACCCCGCTCAAGACCGTGCAGCTCGGGCTGGTGC
GGGTCGATACCAACTCCGGCTACACGGACGTCGTGTGGGCCGAAAACAAAGGCAAGCCACCGGAGCAGAT
CGACGACGAGTTCTGGCTCTCGTCCTATGTACGTTTTCGCGAGAGCTACAACTTCTCAAGCCACGACGCA
GAGTTCGGCATGGTGGAGCTGATGTCCTACGGCGAGACGTTTACCGAGTACCGCAACTTCCAATTGTCCT
CCAAAGGCTATCTGGAAGTGCTGGGGACCAACCGGCAGATTCGTACTGACATCAACAATATCAATTTCCT
TGAGCGTAAAGACCGGGCAGGCACCGCCCAGGTGCGGATCACCAAAACCGTGCTGGATCGCAACGGCACC
CCCGATCCCCAGCTGGCCCCGGTGACTTGGGTGGCCACGGTGACCTACGACTACAACAACCCGGCCAAAA
AAGCCGGTGACCAGTGGCTAAACCCCCGAGGTTTTGGGGTCAAGGCCTACACGATGACCCAGGAAGTGGG
GGTGTCCAATGGGAAATAA
 Primer design