SecReT4
Protein ID: 71725313
T4SS name [ID]VirB [459]
Gene symbol-
Locus tagPSPPH_B0034
StrainPseudomonas syringae pv. phaseolicola 1448A
Repliconplasmid small plasmid [GenBank: NC_007275] [Browse all T4SS(s) in this replicon]
Location [Strand]27219..28028 [+]
Productconjugal transfer protein
Component typeVirB9
UniProt IDQ48B07
KEGG IDpsp:PSPPH_B0034
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 4.8e-46, Aligned region: 33..242
Protein Sequence: 269 a.a.     [Download]
>gi|71725313|ref|YP_272289.1| conjugal transfer protein [Pseudomonas syringae pv. phaseolicola 1448A]
MGNKAASGLTALLLLTSALPVLAESMGTGSALDRRVQTAIYSPDEVFRVQATVGRGALVQLQSNETINQD
TGLMVSGDPKAWSIGPNKAGNMVSLKPITDQEPDTNLTINTNRRTYLIELKLVKRTQDSTYLLRFTYPES
PKKTGDVRRDPGNPCDGPVQNGPYQKRSDSESRSIAPFEGWDNGMLTCFRFTGNGPRPVLYQVLPDGTET
VADAHNEQNVVVVHGVSRLFRFRLNSLVVEVRPTAQVNTGYNFNGTTTGEIRELKHAEQ
 
Nucleotide Sequence: 810 bp     [Download]
>gi|71725269|ref|NC_007275.1|:27219-28028 Pseudomonas syringae pv. phaseolicola 1448A small plasmid, complete sequence
ATGGGAAATAAAGCGGCTTCTGGCCTCACCGCCTTGTTGCTCCTGACGTCTGCCCTGCCCGTCCTCGCCG
AGAGCATGGGCACCGGTTCGGCACTGGACCGCCGTGTACAGACGGCCATTTATTCGCCTGACGAGGTGTT
CAGGGTGCAAGCGACGGTTGGCCGTGGAGCGCTCGTCCAGCTCCAATCCAACGAGACGATCAATCAGGAC
ACCGGGCTTATGGTCTCGGGCGATCCCAAAGCTTGGTCAATTGGCCCCAACAAGGCTGGCAACATGGTCT
CGCTCAAGCCGATCACCGATCAGGAACCCGACACGAACCTGACAATTAACACCAATCGGCGTACCTATCT
GATTGAGCTGAAGCTGGTAAAGCGCACCCAGGACTCGACGTATCTGCTGCGCTTCACCTACCCCGAGTCG
CCCAAAAAGACCGGCGATGTACGCCGTGATCCCGGCAACCCTTGCGATGGTCCGGTGCAAAACGGCCCCT
ATCAAAAGCGCTCCGATTCAGAGAGCAGGTCCATAGCGCCGTTTGAGGGTTGGGACAACGGCATGCTGAC
TTGCTTCCGGTTTACCGGCAACGGGCCGCGCCCGGTGCTGTACCAGGTACTGCCCGATGGCACCGAAACC
GTGGCCGATGCGCACAACGAACAGAACGTGGTGGTGGTGCACGGCGTCAGCCGGCTGTTCCGCTTCCGGC
TGAACAGCCTGGTGGTGGAAGTGCGGCCTACCGCCCAGGTGAACACGGGGTACAACTTCAACGGGACCAC
CACCGGCGAGATTCGGGAGCTCAAGCATGCAGAACAATGA
 Primer design