SecReT4
Protein ID: 71725319
T4SS name [ID]VirB [459]
Gene symbol-
Locus tagPSPPH_B0026
StrainPseudomonas syringae pv. phaseolicola 1448A
Repliconplasmid small plasmid [GenBank: NC_007275] [Browse all T4SS(s) in this replicon]
Location [Strand]20787..21125 [+]
Productconjugal transfer protein
Component typeVirB2
UniProt IDQ48B15
KEGG IDpsp:PSPPH_B0026
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 112 a.a.     [Download]
>gi|71725319|ref|YP_272281.1| conjugal transfer protein [Pseudomonas syringae pv. phaseolicola 1448A]
MMIKRTLVPNKDELCILLVALACLPDIASADWYTTLQQWGSIVRLGLYTLAGTLGLICLIWSGAKWMIAR
STGDRSHTFMDYLESMGVLLVVGASVLLGTAAWQVFGTGVPG
 
Nucleotide Sequence: 339 bp     [Download]
>gi|71725269|ref|NC_007275.1|:20787-21125 Pseudomonas syringae pv. phaseolicola 1448A small plasmid, complete sequence
ATGATGATCAAACGTACCCTTGTGCCCAACAAAGACGAGCTGTGCATTCTGCTGGTGGCTCTGGCCTGTC
TGCCCGACATCGCTTCTGCTGACTGGTACACCACACTGCAGCAGTGGGGCTCCATTGTCCGCCTGGGCCT
CTACACCCTGGCGGGAACCCTGGGCCTGATTTGCCTGATCTGGTCAGGTGCCAAATGGATGATTGCTCGC
TCCACGGGCGACCGTTCGCACACCTTCATGGACTACCTGGAGTCGATGGGTGTGCTGCTGGTGGTGGGGG
CTTCGGTGCTCCTCGGCACAGCGGCCTGGCAAGTGTTCGGCACCGGCGTACCGGGTTGA
 Primer design