SecReT4
Protein ID: 71725323
T4SS name [ID]VirB [459]
Gene symbol-
Locus tagPSPPH_B0032
StrainPseudomonas syringae pv. phaseolicola 1448A
Repliconplasmid small plasmid [GenBank: NC_007275] [Browse all T4SS(s) in this replicon]
Location [Strand]26101..26403 [+]
Productconjugal transfer protein
Component typeVirB7
UniProt IDQ48B09
KEGG IDpsp:PSPPH_B0032
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 100 a.a.     [Download]
>gi|71725323|ref|YP_272287.1| conjugal transfer protein [Pseudomonas syringae pv. phaseolicola 1448A]
MTFRLALSGLLSAALLAGCGSAPKLSKPEGQWEDMPFTHAPAPRAAPVTKPAPVHDRVLPAASPAPKAQS
LKTTQQKRPAAASPAKPAEAPPNDSKCSAN
 
Nucleotide Sequence: 303 bp     [Download]
>gi|71725269|ref|NC_007275.1|:26101-26403 Pseudomonas syringae pv. phaseolicola 1448A small plasmid, complete sequence
ATGACTTTCAGACTTGCTTTAAGCGGGCTGCTTTCGGCTGCCCTGCTGGCAGGGTGTGGCTCTGCACCCA
AACTTTCCAAACCCGAGGGTCAGTGGGAAGACATGCCATTCACCCATGCCCCTGCACCTCGGGCTGCCCC
CGTGACAAAGCCCGCTCCCGTGCATGACCGAGTGCTGCCAGCAGCGAGCCCTGCGCCCAAGGCCCAGTCG
CTCAAGACCACCCAGCAAAAGCGCCCGGCAGCCGCCTCCCCGGCAAAGCCTGCCGAGGCCCCGCCCAACG
ACTCTAAATGCTCCGCGAACTGA
 Primer design