SecReT4
Protein ID: 71725325
T4SS name [ID]VirB [459]
Gene symbol-
Locus tagPSPPH_B0027
StrainPseudomonas syringae pv. phaseolicola 1448A
Repliconplasmid small plasmid [GenBank: NC_007275] [Browse all T4SS(s) in this replicon]
Location [Strand]21138..21626 [+]
Productconjugal transfer protein
Component typeVirB3
UniProt IDQ48B14
KEGG IDpsp:PSPPH_B0027
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 162 a.a.     [Download]
>gi|71725325|ref|YP_272282.1| conjugal transfer protein [Pseudomonas syringae pv. phaseolicola 1448A]
MASNEVLKRLTFESYNAMSRPAMFWNIPIMPMVGLLMGGLVFGVAATFLLSWVWGLVAAAPFLIALIALR
VVGLIDPQYLRRIRFARRRLWLNLKYGKPLLLTPFNPQWSEFYGARFSQKRYAPGKESAIDALSGPRTHG
DTARQPPGESDPVERGFQRNPQ
 
Nucleotide Sequence: 489 bp     [Download]
>gi|71725269|ref|NC_007275.1|:21138-21626 Pseudomonas syringae pv. phaseolicola 1448A small plasmid, complete sequence
ATGGCCAGTAACGAAGTACTCAAGAGACTGACCTTCGAAAGCTACAACGCCATGAGTCGGCCCGCGATGT
TCTGGAACATTCCCATCATGCCGATGGTGGGCTTGCTGATGGGTGGCCTGGTCTTTGGTGTGGCCGCGAC
GTTCCTGCTGTCCTGGGTGTGGGGCCTGGTGGCTGCCGCCCCTTTCCTGATTGCTCTCATCGCCTTGAGG
GTCGTGGGCCTGATTGATCCTCAATATTTGCGCCGTATCCGCTTCGCACGGCGGCGTCTCTGGCTGAACC
TCAAGTACGGCAAACCGTTGTTGCTGACTCCCTTTAATCCGCAATGGAGTGAATTCTATGGCGCACGATT
TTCACAAAAGCGTTATGCCCCCGGAAAAGAAAGTGCCATTGATGCGCTATCCGGTCCACGAACACATGGT
GACACTGCCCGGCAACCGCCTGGTGAGTCTGATCCAGTTGAAAGGGGTTTCCAGCGAAACCCGCAGTGA
 Primer design