SecReT4
Protein ID: 71725328
T4SS name [ID]VirB [459]
Gene symbol-
Locus tagPSPPH_B0025
StrainPseudomonas syringae pv. phaseolicola 1448A
Repliconplasmid small plasmid [GenBank: NC_007275] [Browse all T4SS(s) in this replicon]
Location [Strand]20077..20790 [+]
Productconjugal transfer protein
Component typeVirB1
UniProt IDQ48B16
KEGG IDpsp:PSPPH_B0025
PDB IDNA
Domain hit(s) vs Pfam SLT [PF01464], Evalue: 3.9e-15, Aligned region: 9..138
Protein Sequence: 237 a.a.     [Download]
>gi|71725328|ref|YP_272280.1| conjugal transfer protein [Pseudomonas syringae pv. phaseolicola 1448A]
MLTTSAFLALAMQCAPSIHPATLTPIVKTESSFNPYAIGVVGRVLPRQPQSLDEAVLAVKKLVAEGADFS
IGLGQINRQHFDVSRPEPVFEPCTNLRMAARELQACYVKVRKTDPDVQSALHKAISCYYSGNPKRGFKAE
AEFGGSSHVQRVLANAGTTTVTVPALEGGSAEPGQLQLQRAQAPASTVEPTYESWDVLRQYPRYLPPAPP
PVSAPSASPAVPASPPDQPATLPKEDQ
 
Nucleotide Sequence: 714 bp     [Download]
>gi|71725269|ref|NC_007275.1|:20077-20790 Pseudomonas syringae pv. phaseolicola 1448A small plasmid, complete sequence
ATGCTCACCACCAGTGCCTTTCTGGCCCTGGCTATGCAATGCGCTCCCTCGATACACCCCGCCACGCTGA
CACCCATCGTCAAGACAGAATCCTCCTTCAATCCCTATGCCATTGGCGTGGTCGGCAGAGTGTTGCCGCG
TCAACCGCAAAGCCTGGATGAAGCCGTATTGGCGGTGAAAAAGCTGGTCGCAGAGGGCGCTGACTTCAGC
ATTGGCCTGGGCCAGATCAACCGGCAGCATTTCGATGTCAGCCGACCCGAACCTGTGTTCGAACCCTGTA
CCAACTTGCGCATGGCAGCGCGAGAGCTACAGGCCTGCTATGTAAAGGTCAGGAAAACCGATCCTGATGT
GCAAAGCGCTTTGCACAAAGCCATTTCCTGTTACTACAGCGGCAACCCAAAACGCGGCTTCAAGGCCGAG
GCCGAATTCGGTGGCAGCAGCCACGTACAACGTGTGTTGGCCAACGCCGGCACGACCACCGTAACCGTCC
CGGCACTGGAAGGCGGCTCCGCTGAGCCAGGCCAGCTTCAGCTCCAGCGCGCTCAGGCACCGGCGTCCAC
CGTTGAGCCGACCTATGAAAGCTGGGACGTGCTGCGCCAGTACCCGCGCTATCTGCCGCCTGCACCACCG
CCTGTTTCTGCTCCATCCGCTTCACCCGCTGTTCCCGCTTCACCTCCTGACCAACCTGCAACTCTTCCTA
AAGAGGATCAATGA
 Primer design