SecReT4
Protein ID: 71907925
T4SS name [ID]Tra_F [598]
Gene symbol-
Locus tagDaro_2306
StrainDechloromonas aromatica RCB
Repliconchromosome [GenBank: NC_007298] [Browse all T4SS(s) in this replicon]
Location [Strand]2486033..2487748 [+]
Productrelaxase
Component typeTraI_F
UniProt IDQ47DN9
KEGG IDdar:Daro_2306
PDB IDNA
Domain hit(s) vs Pfam TraI_2 [PF07514], Evalue: 1.5e-95, Aligned region: 30..350
Protein Sequence: 571 a.a.     [Download]
>gi|71907925|ref|YP_285512.1| relaxase [Dechloromonas aromatica RCB]
MPTSHSFRHRRTAMPATPTPVTLYPASDPGFAAVPVDDLLAGEADLIARIKLCYGIDRDSFERDVLMLVR
RYAACVHLLPATADNYFSKPGGLLRLGLETAFFSLQGTDAHIFSGRMSISARRQLEPRWRHATFIAGLCC
ELHRLMSHIIVTDAAGEAWPAFLRPLADWLASRGSERYFLRWRPQAVEARGLGLFALPHVVPPAVMADLS
EGNAVIVPHLLASIGGIPVYRDHNILDELVRRSLALVIDRNLVASADRYGSPQYGSHLERYLVDALRRLT
SGNSAWIANREKSRLWFGQDGLFLVWPGAAEDVQQLLEADQLAGIPKAPETMLELLVAAGVFEAAAAGRA
TWSIQPPGAKAPLEAVKLSTPAILLAGIEPPPVALPQVLEFKPAPASAPVARQTPPSMPPPAPVKSGTQF
SLIPPSEPPAESDVRVAPVEETPGSASPEPATAPPSATFDLQAPMRLNPVVRDALAEAVRTLNDGMGPPT
VCTVAQGVFVPLEEFGRRGVQPSLAMRALIEANLLVKPNRNGPPTLSREFNGNPTVGIVLDPRCVSGLDL
AGFAAPPAEGS
 
Nucleotide Sequence: 1716 bp     [Download]
>gi|71905642|ref|NC_007298.1|:2486033-2487748 Dechloromonas aromatica RCB, complete genome
ATGCCTACTTCGCATTCTTTCCGGCATCGCCGTACCGCCATGCCCGCCACGCCAACGCCTGTCACTTTAT
ACCCCGCCTCCGACCCCGGTTTCGCCGCCGTGCCGGTCGATGATCTGCTGGCCGGCGAAGCAGACCTGAT
CGCACGCATCAAGCTCTGCTACGGCATCGACCGGGACAGCTTCGAGCGCGATGTCCTAATGCTGGTGCGC
CGCTACGCCGCCTGCGTGCATCTGCTGCCGGCGACCGCCGACAACTACTTCAGCAAACCGGGCGGCCTCT
TGCGGCTCGGCCTGGAGACCGCTTTCTTCAGCCTGCAAGGCACCGACGCACACATTTTTTCGGGGCGGAT
GAGCATCTCGGCACGCCGCCAACTGGAACCGCGCTGGCGCCATGCAACATTCATCGCCGGGCTGTGTTGC
GAATTGCACCGGCTGATGAGCCATATCATCGTCACCGATGCCGCCGGCGAGGCGTGGCCGGCCTTCCTGC
GGCCGCTGGCCGACTGGCTGGCAAGCCGGGGCAGCGAGCGCTATTTCCTGCGCTGGCGGCCCCAAGCCGT
CGAGGCGCGCGGCCTGGGCCTGTTCGCCCTGCCCCATGTGGTGCCGCCCGCGGTGATGGCCGACCTCTCC
GAGGGCAACGCAGTCATCGTGCCGCATTTGCTGGCCAGCATCGGCGGCATTCCGGTCTATCGCGACCACA
ACATCCTCGACGAACTGGTCCGCCGCTCGCTGGCGCTAGTCATCGACCGCAACCTGGTCGCCAGCGCCGA
CCGCTACGGTTCGCCGCAATACGGCTCGCACCTGGAGCGCTACCTGGTCGACGCCCTGCGCCGGCTCACC
AGTGGCAACTCGGCCTGGATAGCCAACCGCGAGAAGTCGCGCCTGTGGTTCGGACAGGACGGTCTGTTCC
TGGTCTGGCCTGGCGCCGCCGAGGATGTTCAGCAACTGCTCGAAGCCGACCAACTGGCCGGCATCCCCAA
GGCGCCCGAGACGATGCTGGAACTGCTGGTGGCCGCTGGTGTGTTCGAAGCGGCGGCAGCGGGCCGCGCG
ACTTGGTCCATCCAGCCGCCCGGCGCCAAGGCCCCGCTGGAAGCCGTCAAGCTCTCGACCCCGGCCATTC
TCCTCGCGGGAATCGAACCGCCCCCCGTCGCCTTGCCCCAAGTACTGGAATTCAAGCCGGCGCCGGCGTC
TGCGCCAGTTGCGCGGCAGACGCCTCCATCCATGCCACCGCCGGCACCGGTGAAGAGCGGCACCCAGTTT
TCGCTCATTCCGCCGTCCGAGCCGCCCGCCGAGAGTGACGTCCGCGTGGCGCCGGTCGAGGAAACACCCG
GATCAGCCTCGCCTGAACCGGCGACGGCACCGCCGTCGGCGACATTCGACTTGCAAGCTCCGATGCGTCT
GAACCCAGTCGTGCGCGACGCCCTGGCCGAGGCCGTTCGCACGCTCAACGATGGCATGGGTCCGCCCACC
GTGTGCACCGTCGCCCAGGGAGTATTCGTACCGCTGGAGGAATTCGGGCGGCGCGGCGTCCAGCCTTCGC
TGGCCATGCGTGCCCTCATCGAGGCGAACCTGCTGGTGAAACCCAACCGCAATGGCCCGCCGACGCTGTC
GCGTGAATTCAACGGCAATCCCACCGTCGGCATTGTGCTCGATCCGCGGTGCGTAAGCGGACTCGATCTG
GCGGGCTTTGCAGCACCACCGGCGGAGGGAAGCTGA
 Primer design